KEGG   Saccharomyces cerevisiae (budding yeast): YCR031CHelp
Entry
YCR031C           CDS       T00005                                 

Gene name
RPS14A, CRY1, RPL59
Definition
(RefSeq) ribosomal 40S subunit protein S14A
  KO
K02955  
small subunit ribosomal protein S14e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Ribosome
Module
Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    YCR031C (RPS14A)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    YCR031C (RPS14A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
SGD: 
UniProt: 
Structure
PDB: 

Jmol
Position
III:complement(join(177500..177906,178214..178220))
Genome map
AA seq 137 aa AA seqDB search
MSNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAA
MLAAQDVAAKCKEVGITAVHVKIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTP
VPSDSTRKKGGRRGRRL
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacgttgttcaagctcgtgacaattcccaagtttttggtgttgctagaatttac
gcttctttcaacgatactttcgttcatgttaccgatttatctggtaaggaaaccatcgcc
agagttactggtggtatgaaggttaaggctgacagagatgaatcttctccatacgctgct
atgttggctgcccaagatgttgccgctaagtgtaaggaagtcggtatcactgccgttcac
gttaagatcagagctaccggtggtactagaaccaagactccaggtccaggtggtcaagct
gctttgagagctttggccagatctggtttgagaattggccgtatcgaagatgttacccca
gttccatctgactccaccagaaagaagggtggtagaagaggtagaagattatga

DBGET integrated database retrieval system