KEGG   Saccharomyces cerevisiae (budding yeast): YCR036WHelp
Entry
YCR036W           CDS       T00005                                 

Gene name
RBK1
Definition
Rbk1p (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YCR036W (RBK1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     YCR036W (RBK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
III:193297..194298
Genome map
AA seq 333 aa AA seqDB search
MGITVIGSLNYDLDTFTDRLPNAGETFRANHFETHAGGKGLNQAAAIGKLKNPSSRYSVR
MIGNVGNDTFGKQLKDTLSDCGVDITHVGTYEGINTGTATILIEEKAGGQNRILIVEGAN
SKTIYDPKQLCEIFPEGKEEEEYVVFQHEIPDPLSIIKWIHANRPNFQIVYNPSPFKAMP
KKDWELVDLLVVNEIEGLQIVESVFDNELVEEIREKIKDDFLGEYRKICELLYEKLMNRK
KRGIVVMTLGSRGVLFCSHESPEVQFLPAIQNVSVVDTTGAGDTFLGGLVTQLYQGETLS
TAIKFSTLASSLTIQRKGAAESMPLYKDVQKDA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgggtattacagtaataggttctctaaactatgatttggacacatttacggatagatta
cctaacgctggagaaactttcagggctaaccacttcgaaacacatgctggtggtaaggga
ttgaaccaagctgcggccattggtaaattaaaaaaccccagcagcagatatagtgttcga
atgattggtaatgttggaaatgatacatttggtaaacaattgaaggacactttatccgat
tgcggagtcgatatcactcacgtcggtacttacgaaggcattaatacgggtaccgctacc
atactaattgaagagaaagctggtggccaaaataggatattgattgtagaaggtgctaac
agcaagactatttatgacccgaaacagttgtgtgaaatttttccagagggcaaggaggaa
gaagagtatgttgtttttcaacacgaaattcctgatcctctttccattattaaatggata
catgcgaacaggccgaattttcagatcgtatataacccctcacctttcaaggccatgcct
aagaaagattgggagttggtagaccttttggtcgttaatgaaattgagggtcttcaaatc
gtggaaagtgtatttgataatgaacttgttgaagaaataagggagaagataaaggacgac
tttttaggagaatatcgtaaaatttgtgagcttttgtatgaaaaactcatgaatcgaaag
aaaagaggaattgtggttatgactttgggttcgagaggggtgcttttctgttcgcacgaa
agccctgaagtacaattccttccggctattcaaaatgtttcggttgttgatactacagga
gctggagatactttcctgggcggtttggttactcaattgtatcaaggagagaccttgtct
acggctataaagttctctacattagctagttcattgaccattcaaagaaaaggtgctgct
gaaagcatgccactgtataaagatgttcagaaagatgcataa

DBGET integrated database retrieval system