KEGG   Saccharomyces cerevisiae (budding yeast): YCR053WHelp
Entry
YCR053W           CDS       T00005                                 

Gene name
THR4
Definition
(RefSeq) threonine synthase THR4
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YCR053W (THR4)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    YCR053W (THR4)
Enzymes [BR:sce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     YCR053W (THR4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
SGD: 
UniProt: 
Structure
PDB: 

Jmol
Position
III:216697..218241
Genome map
AA seq 514 aa AA seqDB search
MPNASQVYRSTRSSSPKTISFEEAIIQGLATDGGLFIPPTIPQVDQATLFNDWSKLSFQD
LAFAIMRLYIAQEEIPDADLKDLIKRSYSTFRSDEVTPLVQNVTGDKENLHILELFHGPT
YAFKDVALQFVGNLFEYFLQRTNANLPEGEKKQITVVGATSGDTGSAAIYGLRGKKDVSV
FILYPTGRISPIQEEQMTTVPDENVQTLSVTGTFDNCQDIVKAIFGDKEFNSKHNVGAVN
SINWARILAQMTYYFYSFFQATNGKDSKKVKFVVPSGNFGDILAGYFAKKMGLPIEKLAI
ATNENDILDRFLKSGLYERSDKVAATLSPAMDILISSNFERLLWYLAREYLANGDDLKAG
EIVNNWFQELKTNGKFQVDKSIIEGASKDFTSERVSNEETSETIKKIYESSVNPKHYILD
PHTAVGVCATERLIAKDNDKSIQYISLSTAHPAKFADAVNNALSGFSNYSFEKDVLPEEL
KKLSTLKKKLKFIERADVELVKNAIEEELAKMKL
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgcctaacgcttcccaagtttacagatctaccagatccagctctccaaagacaatctct
tttgaagaggctatcattcaaggtctggccactgacggtggtcttttcattccaccaact
attccacaagtggaccaagccactcttttcaatgattggtcaaagctctccttccaagac
ttagcctttgctatcatgagactatacattgcccaagaagagattccagatgctgatcta
aaggacttgatcaagagatcttattctactttccgttctgatgaagtcacccccttggtg
caaaacgtcactggtgacaaggagaatttgcacattttagaattattccacggtcctacc
tacgctttcaaagacgttgctttacaatttgtcggtaatctttttgaatacttcttacaa
agaaccaacgccaatttacctgaaggcgagaaaaagcaaatcactgtggtcggtgctact
tccggtgacactggttctgcagccatctacggtttaagaggcaaaaaggacgtttccgtt
ttcatcttatatccaaccggtagaatttccccaattcaagaagaacaaatgaccaccgtt
ccagatgaaaacgtccagactttgtctgttaccggtactttcgacaactgtcaagatatc
gtcaaagctattttcggtgacaaagaattcaactctaaacacaacgtcggtgctgttaac
tccatcaactgggcaagaatcttggcccaaatgacctattacttttattcattcttccaa
gccaccaacggtaaggactccaagaaggtcaagttcgttgtgccaagtgggaacttcggt
gatatattggccggttattttgccaagaaaatgggtttgcctattgaaaaactggccatc
gctaccaatgaaaacgacattttggacagatttttgaaatctggtctatacgaaagatca
gacaaggttgctgctactttatccccagcaatggatatcttaatctcttctaactttgaa
agactactatggtacctagctcgtgaatacctagctaatggtgatgatttgaaagccggt
gaaatcgtcaacaattggttccaggaattgaagaccaacggtaagttccaagttgacaaa
tccatcattgaaggcgcatcaaaggactttacatcagaaagagtttccaatgaagaaaca
tctgaaacaatcaagaagatctacgaatcatctgtaaatccaaaacattacatcttagat
cctcacacagctgtcggtgtttgcgccacagaaagattgattgcaaaagataatgacaag
tccatccaatacatttctctatctaccgctcacccagctaaatttgccgatgctgtaaac
aatgcattgtctggattttccaattattcatttgaaaaggatgttttgcctgaggaattg
aagaaactatccacattaaagaagaaattaaaattcatcgaaagagctgacgttgaattg
gtcaaaaacgctattgaagaagaacttgctaaaatgaaattataa

DBGET integrated database retrieval system