KEGG   Saccharomyces cerevisiae (budding yeast): YCR053WHelp
Entry
YCR053W           CDS       T00005                                 

Gene name
THR4
Definition
threonine synthase THR4 (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YCR053W (THR4)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YCR053W (THR4)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    YCR053W (THR4)
Enzymes [BR:sce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     YCR053W (THR4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
III:216697..218241
Genome map
AA seq 514 aa AA seqDB search
MPNASQVYRSTRSSSPKTISFEEAIIQGLATDGGLFIPPTIPQVDQATLFNDWSKLSFQD
LAFAIMRLYIAQEEIPDADLKDLIKRSYSTFRSDEVTPLVQNVTGDKENLHILELFHGPT
YAFKDVALQFVGNLFEYFLQRTNANLPEGEKKQITVVGATSGDTGSAAIYGLRGKKDVSV
FILYPTGRISPIQEEQMTTVPDENVQTLSVTGTFDNCQDIVKAIFGDKEFNSKHNVGAVN
SINWARILAQMTYYFYSFFQATNGKDSKKVKFVVPSGNFGDILAGYFAKKMGLPIEKLAI
ATNENDILDRFLKSGLYERSDKVAATLSPAMDILISSNFERLLWYLAREYLANGDDLKAG
EIVNNWFQELKTNGKFQVDKSIIEGASKDFTSERVSNEETSETIKKIYESSVNPKHYILD
PHTAVGVCATERLIAKDNDKSIQYISLSTAHPAKFADAVNNALSGFSNYSFEKDVLPEEL
KKLSTLKKKLKFIERADVELVKNAIEEELAKMKL
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgcctaacgcttcccaagtttacagatctaccagatccagctctccaaagacaatctct
tttgaagaggctatcattcaaggtctggccactgacggtggtcttttcattccaccaact
attccacaagtggaccaagccactcttttcaatgattggtcaaagctctccttccaagac
ttagcctttgctatcatgagactatacattgcccaagaagagattccagatgctgatcta
aaggacttgatcaagagatcttattctactttccgttctgatgaagtcacccccttggtg
caaaacgtcactggtgacaaggagaatttgcacattttagaattattccacggtcctacc
tacgctttcaaagacgttgctttacaatttgtcggtaatctttttgaatacttcttacaa
agaaccaacgccaatttacctgaaggcgagaaaaagcaaatcactgtggtcggtgctact
tccggtgacactggttctgcagccatctacggtttaagaggcaaaaaggacgtttccgtt
ttcatcttatatccaaccggtagaatttccccaattcaagaagaacaaatgaccaccgtt
ccagatgaaaacgtccagactttgtctgttaccggtactttcgacaactgtcaagatatc
gtcaaagctattttcggtgacaaagaattcaactctaaacacaacgtcggtgctgttaac
tccatcaactgggcaagaatcttggcccaaatgacctattacttttattcattcttccaa
gccaccaacggtaaggactccaagaaggtcaagttcgttgtgccaagtgggaacttcggt
gatatattggccggttattttgccaagaaaatgggtttgcctattgaaaaactggccatc
gctaccaatgaaaacgacattttggacagatttttgaaatctggtctatacgaaagatca
gacaaggttgctgctactttatccccagcaatggatatcttaatctcttctaactttgaa
agactactatggtacctagctcgtgaatacctagctaatggtgatgatttgaaagccggt
gaaatcgtcaacaattggttccaggaattgaagaccaacggtaagttccaagttgacaaa
tccatcattgaaggcgcatcaaaggactttacatcagaaagagtttccaatgaagaaaca
tctgaaacaatcaagaagatctacgaatcatctgtaaatccaaaacattacatcttagat
cctcacacagctgtcggtgtttgcgccacagaaagattgattgcaaaagataatgacaag
tccatccaatacatttctctatctaccgctcacccagctaaatttgccgatgctgtaaac
aatgcattgtctggattttccaattattcatttgaaaaggatgttttgcctgaggaattg
aagaaactatccacattaaagaagaaattaaaattcatcgaaagagctgacgttgaattg
gtcaaaaacgctattgaagaagaacttgctaaaatgaaattataa

DBGET integrated database retrieval system