KEGG   Saccharomyces cerevisiae (budding yeast): YCR084CHelp
Entry
YCR084C           CDS       T00005                                 

Gene name
TUP1, AAR1, AER2, AMM1, CRT4, CYC9, FLK1, ROX4, SFL2, UMR7
Definition
(RefSeq) chromatin-silencing transcriptional regulator TUP1
  KO
K06666  
glucose repression regulatory protein TUP1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YCR084C (TUP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
III:complement(260311..262452)
Genome map
AA seq 713 aa AA seqDB search
MTASVSNTQNKLNELLDAIRQEFLQVSQEANTYRLQNQKDYDFKMNQQLAEMQQIRNTVY
ELELTHRKMKDAYEEEIKHLKLGLEQRDHQIASLTVQQQRQQQQQQQVQQHLQQQQQQLA
AASASVPVAQQPPATTSATATPAANTTTGSPSAFPVQASRPNLVGSQLPTTTLPVVSSNA
QQQLPQQQLQQQQLQQQQPPPQVSVAPLSNTAINGSPTSKETTTLPSVKAPESTLKETEP
ENNNTSKINDTGSATTATTTTATETEIKPKEEDATPASLHQDHYLVPYNQRANHSKPIPP
FLLDLDSQSVPDALKKQTNDYYILYNPALPREIDVELHKSLDHTSVVCCVKFSNDGEYLA
TGCNKTTQVYRVSDGSLVARLSDDSAANNHRNSITENNTTTSTDNNTMTTTTTTTITTTA
MTSAAELAKDVENLNTSSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMI
LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGK
YIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSV
KLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKK
SGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWKYKKIAPN
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgactgccagcgtttcgaatacgcagaataagctgaatgagcttctcgatgccatcaga
caggagtttctccaagtctcacaagaggcaaatacctaccgtcttcaaaaccaaaaggat
tacgatttcaaaatgaaccagcagctggctgagatgcagcagataagaaacaccgtctac
gaactggaactaactcacaggaaaatgaaggacgcgtacgaagaagagatcaagcacttg
aaactagggctggagcaaagagaccatcaaattgcatctttgaccgtccagcaacagcgg
caacagcaacagcagcaacaggtccagcagcatttacaacagcaacagcagcagctagcc
gctgcatctgcatctgttccagttgcgcaacaaccaccggctactacttcggccaccgcc
actccagcagcaaacacaactactggttcgccatcggccttcccagtacaagctagccgt
cctaatctggttggctcacagttgcctaccaccactttgcctgtggtgtcctcaaacgcc
caacaacaactaccacaacagcaactgcaacagcagcaacttcaacaacagcaaccacct
ccccaggtttccgtggcaccattgagtaacacagccatcaacggatctcctacttctaaa
gagaccactactttaccctctgtcaaggcacctgaatctacgttgaaagaaactgaaccg
gaaaataataatacctcgaagataaatgacaccggatccgccaccacggccaccactacc
accgcaactgaaactgaaatcaaacctaaggaggaagacgccaccccggctagtttgcac
caggatcactacttagtcccttataatcaaagagcaaaccactctaaacctatcccacct
ttccttttggatctagattcccagtctgttcccgatgctctgaagaagcaaacaaatgat
tattatattttatacaacccggcactaccaagagaaattgacgttgagttacacaaatct
ttggatcatacttcagttgtttgttgcgtgaagttcagtaacgatggtgaatacttagcc
acaggctgcaacaaaactactcaagtgtatcgcgtttcagatggttctctggtggcccgt
ctatctgacgattctgctgccaataaccatcgaaattcgatcactgaaaataacaccacc
acgtccacggataacaatacaatgacaaccactactaccaccacaattactaccacagcg
atgacttcggcagcagaattggcaaaagatgtggaaaacctgaacacttcgtcttcccca
tcatccgacttgtatatccgttcagtgtgtttttctccagatgggaaatttttggcaaca
ggtgctgaagacagactgattagaatttgggatattgaaaatagaaagattgttatgatt
cttcaaggccacgaacaagatatttattcattggactactttccctcaggtgacaaatta
gtctccggttctggtgaccgtaccgttcgtatttgggacttacgtacaggccagtgttca
ttgactttatccattgaagatggtgttaccaccgtcgctgtatcaccaggtgatggtaaa
tacatcgctgctggttctctagatcgtgctgtgagagtttgggattccgagaccggattc
ttggtggaaagactagattcggaaaacgaatccggtacaggccacaaggactctgtttat
agcgttgtcttcactagagatggacaaagcgttgtatccggctcattagatagatctgtt
aagctctggaatttgcagaatgcaaacaacaagagcgattcgaaaactccaaattccggc
acttgtgaagttacgtatatcgggcataaagactttgtattgtccgtggccaccacacaa
aatgatgagtacatcttgtccggttccaaagatcgtggtgtcctgttttgggataagaaa
tccggcaatccgttattgatgttgcaaggtcataggaattcagttatatctgtggctgtg
gcaaacgggtctccgctgggtccagaatataacgtttttgctactggtagcggtgattgt
aaagcaaggatttggaagtataaaaaaatagcgccaaattaa

DBGET integrated database retrieval system