KEGG   Saccharomyces cerevisiae (budding yeast): YCR084CHelp
Entry
YCR084C           CDS       T00005                                 

Gene name
TUP1, AAR1, AER2, AMM1, CRT4, CYC9, FLK1, ROX4, SFL2, UMR7
Definition
Tup1p
Orthology
K06666  
glucose repression regulatory protein TUP1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YCR084C (TUP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
III:complement(260311..262452)
Genome map
AA seq 713 aa AA seqDB search
MTASVSNTQNKLNELLDAIRQEFLQVSQEANTYRLQNQKDYDFKMNQQLAEMQQIRNTVY
ELELTHRKMKDAYEEEIKHLKLGLEQRDHQIASLTVQQQRQQQQQQQVQQHLQQQQQQLA
AASASVPVAQQPPATTSATATPAANTTTGSPSAFPVQASRPNLVGSQLPTTTLPVVSSNA
QQQLPQQQLQQQQLQQQQPPPQVSVAPLSNTAINGSPTSKETTTLPSVKAPESTLKETEP
ENNNTSKINDTGSATTATTTTATETEIKPKEEDATPASLHQDHYLVPYNQRANHSKPIPP
FLLDLDSQSVPDALKKQTNDYYILYNPALPREIDVELHKSLDHTSVVCCVKFSNDGEYLA
TGCNKTTQVYRVSDGSLVARLSDDSAANNHRNSITENNTTTSTDNNTMTTTTTTTITTTA
MTSAAELAKDVENLNTSSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMI
LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGK
YIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSV
KLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKK
SGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWKYKKIAPN
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgactgccagcgtttcgaatacgcagaataagctgaatgagcttctcgatgccatcaga
caggagtttctccaagtctcacaagaggcaaatacctaccgtcttcaaaaccaaaaggat
tacgatttcaaaatgaaccagcagctggctgagatgcagcagataagaaacaccgtctac
gaactggaactaactcacaggaaaatgaaggacgcgtacgaagaagagatcaagcacttg
aaactagggctggagcaaagagaccatcaaattgcatctttgaccgtccagcaacagcgg
caacagcaacagcagcaacaggtccagcagcatttacaacagcaacagcagcagctagcc
gctgcatctgcatctgttccagttgcgcaacaaccaccggctactacttcggccaccgcc
actccagcagcaaacacaactactggttcgccatcggccttcccagtacaagctagccgt
cctaatctggttggctcacagttgcctaccaccactttgcctgtggtgtcctcaaacgcc
caacaacaactaccacaacagcaactgcaacagcagcaacttcaacaacagcaaccacct
ccccaggtttccgtggcaccattgagtaacacagccatcaacggatctcctacttctaaa
gagaccactactttaccctctgtcaaggcacctgaatctacgttgaaagaaactgaaccg
gaaaataataatacctcgaagataaatgacaccggatccgccaccacggccaccactacc
accgcaactgaaactgaaatcaaacctaaggaggaagacgccaccccggctagtttgcac
caggatcactacttagtcccttataatcaaagagcaaaccactctaaacctatcccacct
ttccttttggatctagattcccagtctgttcccgatgctctgaagaagcaaacaaatgat
tattatattttatacaacccggcactaccaagagaaattgacgttgagttacacaaatct
ttggatcatacttcagttgtttgttgcgtgaagttcagtaacgatggtgaatacttagcc
acaggctgcaacaaaactactcaagtgtatcgcgtttcagatggttctctggtggcccgt
ctatctgacgattctgctgccaataaccatcgaaattcgatcactgaaaataacaccacc
acgtccacggataacaatacaatgacaaccactactaccaccacaattactaccacagcg
atgacttcggcagcagaattggcaaaagatgtggaaaacctgaacacttcgtcttcccca
tcatccgacttgtatatccgttcagtgtgtttttctccagatgggaaatttttggcaaca
ggtgctgaagacagactgattagaatttgggatattgaaaatagaaagattgttatgatt
cttcaaggccacgaacaagatatttattcattggactactttccctcaggtgacaaatta
gtctccggttctggtgaccgtaccgttcgtatttgggacttacgtacaggccagtgttca
ttgactttatccattgaagatggtgttaccaccgtcgctgtatcaccaggtgatggtaaa
tacatcgctgctggttctctagatcgtgctgtgagagtttgggattccgagaccggattc
ttggtggaaagactagattcggaaaacgaatccggtacaggccacaaggactctgtttat
agcgttgtcttcactagagatggacaaagcgttgtatccggctcattagatagatctgtt
aagctctggaatttgcagaatgcaaacaacaagagcgattcgaaaactccaaattccggc
acttgtgaagttacgtatatcgggcataaagactttgtattgtccgtggccaccacacaa
aatgatgagtacatcttgtccggttccaaagatcgtggtgtcctgttttgggataagaaa
tccggcaatccgttattgatgttgcaaggtcataggaattcagttatatctgtggctgtg
gcaaacgggtctccgctgggtccagaatataacgtttttgctactggtagcggtgattgt
aaagcaaggatttggaagtataaaaaaatagcgccaaattaa

DBGET integrated database retrieval system