KEGG   Saccharomyces cerevisiae (budding yeast): YCR108CHelp
Entry
YCR108C           CDS       T00005                                 

Definition
hypothetical protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
III:complement(315997..316188)
Genome map
AA seq 63 aa AA seqDB search
MPYSPSLILMGHTHTDATVYTTLKLPYSHTPIHGPFSLNQYQMHPHHYARHLPQRSIPCA
IYP
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atgccatactcaccttcacttatattgatggggcatacgcacacggatgctacagtatat
accactctcaagttaccctactctcacactccaatccatggcccattctcactaaatcag
taccaaatgcacccacatcattatgcacggcacttgcctcagcggtctataccctgtgcc
atttacccataa

DBGET integrated database retrieval system