KEGG   Saccharomyces cerevisiae (budding yeast): YDL003WHelp
Entry
YDL003W           CDS       T00005                                 

Gene name
MCD1, PDS3, RHC21, SCC1
Definition
Mcd1p
Orthology
K06670  
cohesin complex subunit SCC1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YDL003W (MCD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
IV:444683..446383
Genome map
AA seq 566 aa AA seqDB search
MVTENPQRLTVLRLATNKGPLAQIWLASNMSNIPRGSVIQTHIAESAKEIAKASGCDDES
GDNEYITLRTSGELLQGIVRVYSKQATFLLTDIKDTLTKISMLFKTSQKMTSTVNRLNTV
TRVHQLMLEDAVTEREVLVTPGLEFLDDTTIPVGLMAQENSMERKVQGAAPWDTSLEVGR
RFSPDEDFEHNNLSSMNLDFDIEEGPITSKSWEEGTRQSSRNFDTHENYIQDDDFPLDDA
GTIGWDLGITEKNDQNNDDDDNSVEQGRRLGESIMSEEPTDFGFDLDIEKEAPAGNIDTI
TDAMTESQPKQTGTRRNSKLLNTKSIQIDEETENSESIASSNTYKEERSNNLLTPQPTNF
TTKRLWSEITESMSYLPDPILKNFLSYESLKKRKIHNGREGSIEEPELNVSLNLTDDVIS
NAGTNDNSFNELTDNMSDFVPIDAGLNEAPFPEENIIDAKTRNEQTTIQTEKVRPTPGEV
ASKAIVQMAKILRKELSEEKEVIFTDVLKSQANTEPENITKREASRGFFDILSLATEGCI
GLSQTEAFGNIKIDAKPALFERFINA
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggttacagaaaatcctcaacgtcttactgttttaagacttgccaccaataagggtcca
ttagcacaaatatggcttgcttcaaatatgtcgaatataccaagaggatcggttatccaa
acacatattgctgaatcagcaaaggaaattgcaaaagcttctggctgtgatgacgaatca
ggggacaatgaatacataactttacgaacatctggcgaattacttcaaggcattgttcgt
gtatattccaaacaggccacttttctccttacagatataaaggacacattaacgaagata
agtatgttatttaaaacaagccagaagatgacttctacagtaaacagactgaacactgta
acaagggttcatcaattgatgttagaagatgccgttacagaaagagaagttttggtcacc
ccagggttagagttcttagatgatactactataccagtgggcttaatggcgcaggagaat
tcgatggaaagaaaagtccaaggtgctgctccctgggatacttcacttgaggtcggtaga
cgattcagtccagatgaagatttcgaacataataatttgtctagtatgaaccttgatttt
gacatcgaggaaggtccgataacttcaaaatcttgggaagaaggaacaagacaaagctca
cgcaactttgatacgcacgaaaattacatacaagatgacgatttccctcttgatgatgct
ggaactattggttgggatctagggattaccgaaaaaaatgaccagaacaacgatgatgac
gataactctgttgagcaaggaagaaggctaggtgaatcaatcatgtctgaggagcctacg
gattttggatttgatctggatatagaaaaagaagcacccgcaggcaatatagatacgata
accgatgccatgacagaatcacagccaaaacaaactggcacaagaaggaactcaaaatta
ctgaataccaaaagtattcaaatcgatgaagaaacagaaaattcagaaagcatagcttca
tccaatacatacaaagaggagagatcgaataatttattgactccacagcccaccaatttt
acgactaaaagattatggagtgaaataactgaaagtatgtcctatttaccagatccaatc
cttaagaacttcttatcctacgaatctctaaaaaaaagaaaaatacataatgggcgagaa
gggtcaattgaagaacctgagttaaacgtgtcgcttaatcttaccgacgatgtaattagt
aatgcgggaacaaacgataactccttcaatgaactgaccgataacatgtcagacttcgta
ccaattgatgctggcttaaatgaggctccttttcctgaagagaatatcatcgacgcaaag
actagaaatgagcaaactaccatccaaactgaaaaagttcgtcctactcccggtgaggtg
gcttctaaagctattgttcaaatggcgaagattttaaggaaggaattaagcgaagaaaaa
gaagtaatattcacggatgtactaaaaagtcaagcaaatacagaaccagaaaatattact
aaaagagaagccagtagaggatttttcgatattttatcacttgctacagaaggatgtatt
ggtttgagtcaaacagaagcattcggaaatattaaaatagacgccaaacctgcactattt
gaaaggtttatcaatgcttaa

DBGET integrated database retrieval system