KEGG   Saccharomyces cerevisiae (budding yeast): YDL003WHelp
Entry
YDL003W           CDS       T00005                                 

Gene name
MCD1, PDS3, RHC21, SCC1
Definition
(RefSeq) kleisin alpha
  KO
K06670  cohesin complex subunit SCC1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YDL003W (MCD1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Sister chromatid cohesion proteins
   Cohesin complex
    YDL003W (MCD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rad21_Rec8_N Rad21_Rec8
Motif
Other DBs
NCBI-GeneID: 851561
NCBI-ProteinID: NP_010281
SGD: S000002161
UniProt: Q12158
Structure
PDB: 

Jmol
Position
IV:444683..446383
Genome map
AA seq 566 aa AA seqDB search
MVTENPQRLTVLRLATNKGPLAQIWLASNMSNIPRGSVIQTHIAESAKEIAKASGCDDES
GDNEYITLRTSGELLQGIVRVYSKQATFLLTDIKDTLTKISMLFKTSQKMTSTVNRLNTV
TRVHQLMLEDAVTEREVLVTPGLEFLDDTTIPVGLMAQENSMERKVQGAAPWDTSLEVGR
RFSPDEDFEHNNLSSMNLDFDIEEGPITSKSWEEGTRQSSRNFDTHENYIQDDDFPLDDA
GTIGWDLGITEKNDQNNDDDDNSVEQGRRLGESIMSEEPTDFGFDLDIEKEAPAGNIDTI
TDAMTESQPKQTGTRRNSKLLNTKSIQIDEETENSESIASSNTYKEERSNNLLTPQPTNF
TTKRLWSEITESMSYLPDPILKNFLSYESLKKRKIHNGREGSIEEPELNVSLNLTDDVIS
NAGTNDNSFNELTDNMSDFVPIDAGLNEAPFPEENIIDAKTRNEQTTIQTEKVRPTPGEV
ASKAIVQMAKILRKELSEEKEVIFTDVLKSQANTEPENITKREASRGFFDILSLATEGCI
GLSQTEAFGNIKIDAKPALFERFINA
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggttacagaaaatcctcaacgtcttactgttttaagacttgccaccaataagggtcca
ttagcacaaatatggcttgcttcaaatatgtcgaatataccaagaggatcggttatccaa
acacatattgctgaatcagcaaaggaaattgcaaaagcttctggctgtgatgacgaatca
ggggacaatgaatacataactttacgaacatctggcgaattacttcaaggcattgttcgt
gtatattccaaacaggccacttttctccttacagatataaaggacacattaacgaagata
agtatgttatttaaaacaagccagaagatgacttctacagtaaacagactgaacactgta
acaagggttcatcaattgatgttagaagatgccgttacagaaagagaagttttggtcacc
ccagggttagagttcttagatgatactactataccagtgggcttaatggcgcaggagaat
tcgatggaaagaaaagtccaaggtgctgctccctgggatacttcacttgaggtcggtaga
cgattcagtccagatgaagatttcgaacataataatttgtctagtatgaaccttgatttt
gacatcgaggaaggtccgataacttcaaaatcttgggaagaaggaacaagacaaagctca
cgcaactttgatacgcacgaaaattacatacaagatgacgatttccctcttgatgatgct
ggaactattggttgggatctagggattaccgaaaaaaatgaccagaacaacgatgatgac
gataactctgttgagcaaggaagaaggctaggtgaatcaatcatgtctgaggagcctacg
gattttggatttgatctggatatagaaaaagaagcacccgcaggcaatatagatacgata
accgatgccatgacagaatcacagccaaaacaaactggcacaagaaggaactcaaaatta
ctgaataccaaaagtattcaaatcgatgaagaaacagaaaattcagaaagcatagcttca
tccaatacatacaaagaggagagatcgaataatttattgactccacagcccaccaatttt
acgactaaaagattatggagtgaaataactgaaagtatgtcctatttaccagatccaatc
cttaagaacttcttatcctacgaatctctaaaaaaaagaaaaatacataatgggcgagaa
gggtcaattgaagaacctgagttaaacgtgtcgcttaatcttaccgacgatgtaattagt
aatgcgggaacaaacgataactccttcaatgaactgaccgataacatgtcagacttcgta
ccaattgatgctggcttaaatgaggctccttttcctgaagagaatatcatcgacgcaaag
actagaaatgagcaaactaccatccaaactgaaaaagttcgtcctactcccggtgaggtg
gcttctaaagctattgttcaaatggcgaagattttaaggaaggaattaagcgaagaaaaa
gaagtaatattcacggatgtactaaaaagtcaagcaaatacagaaccagaaaatattact
aaaagagaagccagtagaggatttttcgatattttatcacttgctacagaaggatgtatt
ggtttgagtcaaacagaagcattcggaaatattaaaatagacgccaaacctgcactattt
gaaaggtttatcaatgcttaa

DBGET integrated database retrieval system