KEGG   Saccharomyces cerevisiae (budding yeast): YDL007C-AHelp
Entry
YDL007C-A         CDS       T00005                                 

Definition
hypothetical protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:complement(436567..436824)
Genome map
AA seq 85 aa AA seqDB search
MFLPIIFHTILTLLNFGKYYCLPIQEDDDKSGKEIEQILDNNIESLGLLLNSMSLSSNFT
TGDPELDSLFQDDLIPELYSVLDGF
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgttccttcctataatttttcacaccatcctaaccctcctgaactttggtaaatattac
tgtttacctattcaagaagacgatgataaatcaggaaaagaaattgaacaaattttagac
aataacatcgagtcattaggactactactaaattcgatgtccttatcctcgaactttacg
acaggcgatcctgaactagattcgctcttccaagatgatttaatccccgagttatatagt
gtattagatggcttctaa

DBGET integrated database retrieval system