KEGG   Saccharomyces cerevisiae (budding yeast): YDL008WHelp
Entry
YDL008W           CDS       T00005                                 

Gene name
APC11
Definition
anaphase promoting complex subunit 11 (EC:6.3.2.-)
Orthology
K03358  
anaphase-promoting complex subunit 11
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YDL008W (APC11)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YDL008W (APC11)
   04113 Meiosis - yeast
    YDL008W (APC11)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    Ring finger protein
     YDL008W (APC11)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:433497..433994
Genome map
AA seq 165 aa AA seqDB search
MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGD
QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSR
RREEMIEEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFLLR
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaaaataaacgaagtgcacagtgtgtttgcttggtcatggcacatccctagc
acatctgatgaggacgcagccaataacgatccaattggcaatgatgaagacgaggatgtc
tgtggtatctgtcgtgccagttataacggtacctgtccaagctgtaaatttccaggcgat
caatgccctttagtgattgggctatgtcatcataacttccatgatcattgtatataccgt
tggcttgatacaccaacctcaaaaggactgtgtccgatgtgtaggcaaactttccagcta
cagaagggtctagcaattaatgacgctcatgtccaaaagttcgttgaaatagtttcaaga
agaagagaagaaatgatagaggagggcgtcgcagaagagtttgtggactttgatgaacca
ataaggcaaaacaccgataacccaatcggtagacagcaagttgataccatcctggacgaa
gactttttgttacgataa

DBGET integrated database retrieval system