KEGG   Saccharomyces cerevisiae (budding yeast): YDL017WHelp
Entry
YDL017W           CDS       T00005                                 

Gene name
CDC7, LSD6, SAS1
Definition
(RefSeq) serine/threonine protein kinase CDC7
  KO
K02214  cell division control protein 7 [EC:2.7.11.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YDL017W (CDC7)
   04113 Meiosis - yeast
    YDL017W (CDC7)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     YDL017W (CDC7)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: Other
  CDC7 family
   YDL017W (CDC7)
DNA replication proteins [BR:sce03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   DDK (Dbf-4 dependent kinase)
    YDL017W (CDC7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH FTA2
Motif
Other DBs
NCBI-GeneID: 851545
NCBI-ProteinID: NP_010267
SGD: S000002175
UniProt: P06243
Position
IV:424209..425732
Genome map
AA seq 507 aa AA seqDB search
MTSKTKNIDDIPPEIKEEMIQLYHDLPGIENEYKLIDKIGEGTFSSVYKAKDITGKITKK
FASHFWNYGSNYVALKKIYVTSSPQRIYNELNLLYIMTGSSRVAPLCDAKRVRDQVIAVL
PYYPHEEFRTFYRDLPIKGIKKYIWELLRALKFVHSKGIIHRDIKPTNFLFNLELGRGVL
VDFGLAEAQMDYKSMISSQNDYDNYANTNHDGGYSMRNHEQFCPCIMRNQYSPNSHNQTP
PMVTIQNGKVVHLNNVNGVDLTKGYPKNETRRIKRANRAGTRGFRAPEVLMKCGAQSTKI
DIWSVGVILLSLLGRRFPMFQSLDDADSLLELCTIFGWKELRKCAALHGLGFEASGLIWD
KPNGYSNGLKEFVYDLLNKECTIGTFPEYSVAFETFGFLQQELHDRMSIEPQLPDPKTNM
DAVDAYELKKYQEEIWSDHYWCFQVLEQCFEMDPQKRSSAEDLLKTPFFNELNENTYLLD
GESTDEDDVVSSSEADLLDKDVLLISE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcaaaacgaagaatatcgatgatatacctccagaaatcaaagaagagatgata
cagctctatcatgatctaccgggtatagaaaatgaatataaactcatagacaagatcggt
gagggaacattttcgtcagtgtataaagccaaagatatcactgggaaaataacaaaaaaa
tttgcatcacatttttggaattatggttcgaactatgttgctttgaagaaaatatacgtt
acctcgtcaccgcaaagaatttataatgagctcaacctgctgtacataatgacgggatct
tcgagagtagcccctctatgtgatgcaaaaagggtgcgagatcaagtcattgctgtttta
ccgtactatccccacgaggagttccgaactttctacagggatctaccaatcaagggaatc
aagaagtacatttgggagctactaagagcattgaagtttgttcattcgaagggaattatt
catagagacatcaaaccgacaaattttttatttaatttggaattggggcgtggagtgctt
gttgattttggtctagccgaggctcaaatggattataaaagcatgatatctagtcaaaac
gattacgacaattatgcaaatacaaaccatgatggtggatattcaatgaggaatcacgaa
caattttgtccatgcattatgcgtaatcaatattctcctaactcacataaccaaacacct
cctatggtcaccatacaaaatggcaaggtcgtccacttaaacaatgtaaatggggtggat
ctgacaaagggttatcctaaaaatgaaacgcgtagaattaaaagggctaatagagcaggg
actcgtggatttcgggcaccagaagtgttaatgaagtgtggggctcaaagcacaaagatt
gatatatggtccgtaggtgttattcttttaagtcttttgggcagaagatttccaatgttc
caaagtttagatgatgcggattctttgctagagttatgtactatttttggttggaaagaa
ttaagaaaatgcgcagcgttgcatggattgggtttcgaagctagtgggctcatttgggat
aaaccaaacggatattctaatggattgaaggaatttgtttatgatttgcttaataaagaa
tgtaccataggtacgttccctgagtacagtgttgcttttgaaacattcggatttctacaa
caagaattacatgacaggatgtccattgaacctcaattacctgaccccaagacaaatatg
gatgctgttgatgcctatgagttgaaaaagtatcaagaagaaatttggtccgatcattat
tggtgcttccaggttttggaacaatgcttcgaaatggatcctcaaaagcgtagttcagca
gaagatttactgaaaaccccgtttttcaatgaattgaatgaaaacacatatttactggat
ggcgagagtactgacgaagatgacgttgtcagctcaagcgaggcagatttgctcgataag
gatgttctcctaatatctgaatag

DBGET integrated database retrieval system