KEGG   Saccharomyces cerevisiae (budding yeast): YDL021WHelp
Entry
YDL021W           CDS       T00005                                 

Gene name
GPM2
Definition
phosphoglycerate mutase family protein GPM2 (EC:5.4.2.11)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YDL021W (GPM2)
   01230 Biosynthesis of amino acids
    YDL021W (GPM2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YDL021W (GPM2)
  Energy metabolism
   00680 Methane metabolism
    YDL021W (GPM2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YDL021W (GPM2)
Enzymes [BR:sce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     YDL021W (GPM2)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   YDL021W (GPM2)
  Exosomal proteins of melanoma cells
   YDL021W (GPM2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:413953..414888
Genome map
AA seq 311 aa AA seqDB search
MTASTPSNVMTLFLLRHGQSELNHENIFCGWIDAKLTEKGKEQARHSAELIEQYCKANNL
RLPQIGYTSRLIRTQQTIETMCEEFKLKPQLQVVYDFNKIKLGDEFGSDDKDNMKIPILQ
TWRLNERHYGSWQGQRKPNVLKEYGKDKYMFIRRDYEGKPPPVDLDREMIQQENEKGSST
GYEFKEPNRQIKYELECSNHDIVLPDSESLREVVYRLNPFLQNVILKLANQYDESSCLIV
GHGSSVRSLLKILEGISDDDIKNVDIPNGIPLVVELDKNNGLKFIRKFYLDPESAKINAE
KVRNEGFIKNP
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaagcacaccatccaatgtcatgacattgttcttgttaaggcatggacaaagt
gaattgaatcacgagaatatattctgtggttggattgacgctaagctaaccgaaaaaggt
aaagaacaagctcgtcattctgccgagctaatcgaacaatattgtaaagctaataatttg
agattaccccagattggttacacctcacgtttaattaggacccaacagaccatagaaacg
atgtgtgaagaatttaagttaaagccacaactgcaggttgtttacgactttaataaaatc
aaacttggagacgaatttggcagtgatgacaaggataatatgaaaatcccgattcttcaa
acttggaggctaaatgaacgtcattacggttcctggcagggccagaggaaaccgaatgtt
ttaaaagaatatggtaaggataaatatatgttcattaggagagattacgagggtaagcca
ccacctgtagatcttgaccgtgagatgattcaacaagaaaatgagaagggctcttctact
gggtacgaattcaaggagccaaacagacaaataaaatatgaattggaatgcagcaatcat
gacattgtattaccggattccgaatctcttcgtgaagtggtttatagattgaatcctttt
ctacaaaatgtcatattaaaattagccaatcaatatgatgaatcttcatgcctgattgtg
ggccatggaagttcagtgagatcgctactgaaaattctggagggtatatcagatgatgac
atcaagaatgttgatattccaaatggtatccccttagtcgttgaattagataagaataat
ggtcttaagtttatcagaaaattctacctagatcctgaatctgctaagatcaatgctgag
aaagtccgtaatgagggtttcataaaaaatccttaa

DBGET integrated database retrieval system