KEGG   Saccharomyces cerevisiae (budding yeast): YDL021WHelp
Entry
YDL021W           CDS       T00005                                 

Gene name
GPM2
Definition
(RefSeq) phosphoglycerate mutase family protein GPM2
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00010  Glycolysis / Gluconeogenesis
sce00260  Glycine, serine and threonine metabolism
sce00680  Methane metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01200  Carbon metabolism
sce01230  Biosynthesis of amino acids
Module
sce_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sce_M00002  Glycolysis, core module involving three-carbon compounds
sce_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YDL021W (GPM2)
  Energy metabolism
   00680 Methane metabolism
    YDL021W (GPM2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YDL021W (GPM2)
Enzymes [BR:sce01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     YDL021W (GPM2)
Membrane trafficking [BR:sce04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    YDL021W (GPM2)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   YDL021W (GPM2)
  Exosomal proteins of melanoma cells
   YDL021W (GPM2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 851541
NCBI-ProteinID: NP_010263
SGD: S000002179
UniProt: Q12008
Position
IV:413953..414888
Genome map
AA seq 311 aa AA seqDB search
MTASTPSNVMTLFLLRHGQSELNHENIFCGWIDAKLTEKGKEQARHSAELIEQYCKANNL
RLPQIGYTSRLIRTQQTIETMCEEFKLKPQLQVVYDFNKIKLGDEFGSDDKDNMKIPILQ
TWRLNERHYGSWQGQRKPNVLKEYGKDKYMFIRRDYEGKPPPVDLDREMIQQENEKGSST
GYEFKEPNRQIKYELECSNHDIVLPDSESLREVVYRLNPFLQNVILKLANQYDESSCLIV
GHGSSVRSLLKILEGISDDDIKNVDIPNGIPLVVELDKNNGLKFIRKFYLDPESAKINAE
KVRNEGFIKNP
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaagcacaccatccaatgtcatgacattgttcttgttaaggcatggacaaagt
gaattgaatcacgagaatatattctgtggttggattgacgctaagctaaccgaaaaaggt
aaagaacaagctcgtcattctgccgagctaatcgaacaatattgtaaagctaataatttg
agattaccccagattggttacacctcacgtttaattaggacccaacagaccatagaaacg
atgtgtgaagaatttaagttaaagccacaactgcaggttgtttacgactttaataaaatc
aaacttggagacgaatttggcagtgatgacaaggataatatgaaaatcccgattcttcaa
acttggaggctaaatgaacgtcattacggttcctggcagggccagaggaaaccgaatgtt
ttaaaagaatatggtaaggataaatatatgttcattaggagagattacgagggtaagcca
ccacctgtagatcttgaccgtgagatgattcaacaagaaaatgagaagggctcttctact
gggtacgaattcaaggagccaaacagacaaataaaatatgaattggaatgcagcaatcat
gacattgtattaccggattccgaatctcttcgtgaagtggtttatagattgaatcctttt
ctacaaaatgtcatattaaaattagccaatcaatatgatgaatcttcatgcctgattgtg
ggccatggaagttcagtgagatcgctactgaaaattctggagggtatatcagatgatgac
atcaagaatgttgatattccaaatggtatccccttagtcgttgaattagataagaataat
ggtcttaagtttatcagaaaattctacctagatcctgaatctgctaagatcaatgctgag
aaagtccgtaatgagggtttcataaaaaatccttaa

DBGET integrated database retrieval system