KEGG   Saccharomyces cerevisiae (budding yeast): YDL028CHelp
Entry
YDL028C           CDS       T00005                                 

Gene name
MPS1, PAC8, RPK1
Definition
Mps1p (EC:2.7.12.2)
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YDL028C (MPS1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     YDL028C (MPS1)
Protein kinases [BR:sce01001]
 Serine/threonine protein kinases: Other group
  TTK family
   YDL028C (MPS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:complement(400997..403291)
Genome map
AA seq 764 aa AA seqDB search
MSTNSFHDYVDLKSRTNTRQFSDDEEFTTPPKLSNFGSALLSHTEKTSASEILSSHNNDK
IANRLEEMDRSSSRSHPPPSMGNLTSGHTSTSSHSTLFGRYLRNNHQTSMTTMNTSDIEI
NVGNSLDKSFERIRNLRQNMKEDITAKYAERRSKRFLISNRTTKLGPAKRAMTLTNIFDE
DVPNSPNQPINARETVELPLEDSHQTNFKETKRNTDYDSIDFGDLNPIQYIKKHNLPTSD
LPLISQIYFDKQREENRQAALRKHSSRELLYKSRSSSSSLSSNNLLANKDNSITSNNGSQ
PRRKVSTGSSSSKSSIEIRRALKENIDTSNNSNFNSPIHKIYKGISRNKDSDSEKREVLR
NISINANHADNLLQQENKRLKRSLDDAITNENINSKNLEVFYHRPAPKPPVTKKVEIVEP
AKSASLSNNRNIITVNDSQYEKIELLGRGGSSRVYKVKGSGNRVYALKRVSFDAFDDSSI
DGFKGEIELLEKLKDQKRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSGMPLDFNFV
RFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRETQI
GTPNYMAPEALVAMNYTQNSENQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQ
NRLLAIMNPDVKIPFPEHTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFM
ISGSIMEDLIRNAVRYGSEKPHISQDDLNDVVDTVLRKFADYKI
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaaactcattccatgattatgtggatttaaaatcgagaactaatacacgacag
ttttcagatgacgaagagttcactacgcctccaaaactaagcaatttcggatcagcttta
ctttcccacacagaaaaaacttcagcatcagagatattatcaagtcataataatgacaag
atcgcaaatcgattagaagaaatggacaggagttcatcaaggagtcaccccccaccgtca
atgggcaatttgacatccggtcatactagtacctcatcgcattcaaccttgttcggacga
tatctgagaaataatcaccagactagcatgacgacgatgaacactagtgacatagagata
aatgttggaaatagtcttgataagagttttgaaaggataaggaatttgcgacaaaatatg
aaagaagatattacggcaaagtatgctgaaaggagaagtaagagatttttaatatccaat
aggacaacgaagctgggtcctgcaaagagagcgatgactttgacaaatatctttgatgag
gatgtgcctaactctccaaaccagccaataaatgcaagggagacagtggaattaccactt
gaggattctcaccaaacaaactttaaagaaacgaagagaaatacggattatgattcaatt
gattttggagatttgaatcctatccagtatattaaaaaacataatcttcccacaagtgac
cttccactaatatctcaaatctactttgataaacaaagagaagaaaatagacaagcagca
ctccgaaaacatagttccagagaattgctttataaaagtaggtcttcttcctcttcactt
tctagtaacaacttattggcaaacaaggacaattctataacatccaataatggttctcaa
cccaggcgaaaagtttctactggatcatcttcatctaagtcatcgatcgaaataagaaga
gctctcaaggagaatattgatactagcaataacagcaatttcaacagcccaattcataaa
atttataaaggaatttccagaaataaagattccgactccgaaaaaagagaagtactgcga
aacataagcataaatgcaaatcacgctgataatctccttcaacaagagaataagagacta
aaacgatcattggatgatgcaataacgaatgagaatataaacagtaaaaatctagaagta
ttttaccatcgacctgctcccaaacctccagtcaccaagaaagttgaaattgttgaacct
gcaaagtccgcttctttatcgaataatagaaatataattacagtaaatgactcccagtac
gaaaaaatagaacttttgggtagaggtggatcctccagagtttacaaggtgaaaggatct
ggcaatagggtatacgcgctcaaaagggtgtcttttgacgcttttgacgattcaagtatt
gatggattcaaaggagaaatagaacttctggaaaaattgaaagaccaaaagcgtgtaatc
caactactagattatgaaatgggggatggtttattgtatttgataatggaatgtggtgat
catgatttgtcacaaatccttaaccaaagaagcggcatgccactggattttaattttgtt
agattctatacaaaggaaatgttgctgtgcattaaagtagttcatgatgcgggcatagtt
cattcggatttaaaacctgcaaattttgttttagtgaaaggtatcttaaaaatcattgat
tttggtatagcaaacgcggtaccggaacatacggtgaatatatatcgtgaaactcaaatt
gggactccaaattatatggcaccagaagcactagttgctatgaattacacacaaaatagt
gagaaccaacatgagggaaacaagtggaaagtggggagaccatctgatatgtggtcatgc
ggttgtattatatatcagatgatttacgggaaacccccatatggcagtttccaaggccaa
aataggctgttggctattatgaatcctgatgtgaaaatcccatttcctgaacatactagc
aataatgaaaagattccaaagtctgccattgaattaatgaaagcatgtctgtacaggaac
ccagacaaaagatggactgtggataaagtcctgagtagcactttccttcaaccttttatg
atatccggatcgattatggaagaccttattaggaatgccgttagatatggctctgagaag
cctcatatatcacaagatgatctcaatgatgtggtagacactgttttaaggaaatttgca
gattacaaaatttag

DBGET integrated database retrieval system