KEGG   Saccharomyces cerevisiae (budding yeast): YDL056WHelp
Entry
YDL056W           CDS       T00005                                 

Gene name
MBP1
Definition
Mbp1p
Orthology
K06647  
transcription factor MBP1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YDL056W (MBP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
IV:352877..355378
Genome map
AA seq 833 aa AA seqDB search
MSNQIYSARYSGVDVYEFIHSTGSIMKRKKDDWVNATHILKAANFAKAKRTRILEKEVLK
ETHEKVQGGFGKYQGTWVPLNIAKQLAEKFSVYDQLKPLFDFTQTDGSASPPPAPKHHHA
SKVDRKKAIRSASTSAIMETKRNNKKAEENQFQSSKILGNPTAAPRKRGRPVGSTRGSRR
KLGVNLQRSQSDMGFPRPAIPNSSISTTQLPSIRSTMGPQSPTLGILEEERHDSRQQQPQ
QNNSAQFKEIDLEDGLSSDVEPSQQLQQVFNQNTGFVPQQQSSLIQTQQTESMATSVSSS
PSLPTSPGDFADSNPFEERFPGGGTSPIISMIPRYPVTSRPQTSDINDKVNKYLSKLVDY
FISNEMKSNKSLPQVLLHPPPHSAPYIDAPIDPELHTAFHWACSMGNLPIAEALYEAGTS
IRSTNSQGQTPLMRSSLFHNSYTRRTFPRIFQLLHETVFDIDSQSQTVIHHIVKRKSTTP
SAVYYLDVVLSKIKDFSPQYRIELLLNTQDKNGDTALHIASKNGDVVFFNTLVKMGALTT
ISNKEGLTANEIMNQQYEQMMIQNGTNQHVNSSNTDLNIHVNTNNIETKNDVNSMVIMSP
VSPSDYITYPSQIATNISRNIPNVVNSMKQMASIYNDLHEQHDNEIKSLQKTLKSISKTK
IQVSLKTLEVLKESSKDENGEAQTNDDFEILSRLQEQNTKKLRKRLIRYKRLIKQKLEYR
QTVLLNKLIEDETQATTNNTVEKDNNTLERLELAQELTMLQLQRKNKLSSLVKKFEDNAK
IHKYRRIIREGTEMNIEEVDSSLDVILQTLIANNNKNKGAEQIITISNANSHA
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaccaaatatactcagcgagatattcgggggttgatgtttatgaattcattcat
tctacaggatctatcatgaaaaggaaaaaggatgattgggtcaatgctacacatatttta
aaggccgccaattttgccaaggctaaaagaacaaggattctagagaaggaagtacttaag
gaaactcatgaaaaagttcagggtggatttggtaaatatcagggtacatgggtcccactg
aacatagcgaaacaactggcagaaaaatttagtgtctacgatcagctgaaaccgttgttc
gactttacgcaaacagatgggtctgcttctccacctcctgctccaaaacatcaccatgcc
tcgaaggtggataggaaaaaggctattagaagtgcaagtacttccgcaattatggaaaca
aaaagaaacaacaagaaagccgaggaaaatcaatttcaaagcagcaaaatattgggaaat
cccacggctgcaccaaggaaaagaggtagaccggtaggatctacgaggggaagtaggcgg
aagttaggtgtcaatttacaacgttctcaaagtgatatgggatttcctagaccggcgata
ccgaattcttcaatatcgacaacgcaacttccctctattagatccaccatgggaccacaa
tcccctacattgggtattctggaagaagaaaggcacgattctcgacagcagcagccgcaa
caaaataattctgcacagttcaaagaaattgatcttgaggacggcttatcaagcgatgtg
gaaccttcacaacaattacaacaagtttttaatcaaaatactggatttgtaccccaacaa
caatcttccttgatacagacacagcaaacagaatcaatggccacgtccgtatcttcctct
ccttcattacctacgtcaccgggcgattttgccgatagtaatccatttgaagagcgattt
cccggtggtggaacatctcctattatttccatgatcccgcgttatcctgtaacttcaagg
cctcaaacatcggatattaatgataaagttaacaaatacctttcaaaattggttgattat
tttatttccaatgaaatgaagtcaaataagtccctaccacaagtgttattgcacccacct
ccacacagcgctccctatatagatgctccaatcgatccagaattacatactgccttccat
tgggcttgttctatgggtaatttaccaattgctgaggcgttgtacgaagccggaacaagt
atcagatcgacaaattctcaaggccaaactccattgatgagaagttccttattccacaat
tcatacactagaagaactttccctagaattttccagctactgcacgagaccgtatttgat
atcgattcgcaatcacaaacagtaattcaccatattgtgaaacgaaaatcaacaacacct
tctgcagtttattatcttgatgttgtgctatctaagatcaaggatttttccccacagtat
agaattgaattacttttaaacacacaagacaaaaatggcgataccgcacttcatattgct
tctaaaaatggagatgttgttttttttaatacactggtcaaaatgggtgcattaactact
atttccaataaggaaggattaaccgccaatgaaataatgaatcaacaatatgagcaaatg
atgatacaaaatggtacaaatcaacatgtcaattcttcaaacacggacttgaatatccac
gttaatacaaacaacattgaaacgaaaaatgatgttaattcaatggtaatcatgtcgcct
gtttctccttcggattacataacctatccatctcaaattgccaccaatatatcaagaaat
attccaaatgtagtgaattctatgaagcaaatggctagcatatacaacgatcttcatgaa
cagcatgacaacgaaataaaaagtttgcaaaaaactttaaaaagcatttctaagacgaaa
atacaggtaagcctaaaaactttagaggtattgaaagagagcagtaaagatgaaaacggc
gaagctcagactaatgatgacttcgaaattttatctcgtctacaagaacaaaatactaag
aaattgagaaaaaggctcatacgatacaaacggttgataaaacaaaagctggaatacagg
caaacggttttattgaacaaattaatagaagatgaaactcaggctaccaccaataacaca
gttgagaaagataataatacgctggaaaggttggaattggctcaagaactaacgatgttg
caattacaaaggaaaaacaaattgagttccttggtgaagaaatttgaagacaatgccaag
attcataaatatagacggattatcagggaaggtacggaaatgaatattgaagaagtagat
agttcgctggatgtaatactacagacattgatagccaacaataataaaaataagggcgca
gaacagatcatcacaatctcaaacgcgaatagtcatgcataa

DBGET integrated database retrieval system