KEGG   Saccharomyces cerevisiae (budding yeast): YDL093WHelp
Entry
YDL093W           CDS       T00005                                 

Gene name
PMT5
Definition
Pmt5p (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:sce00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:289909..292140
Genome map
AA seq 743 aa AA seqDB search
MNKEHLLKVDPIPDVTIKRGPLRSFLITKPCDNLSSLRTVTSSKEKLLVGCLLIFTAIVR
LHNISLPNSVVFGENEVGTFVSQYVNNIFFTDVHPPLVAMLYATVSSVFGYKGLFNYGNI
GTEYTANVPYVAMRFFSATLGIVSVLVLYLTLRVSGVKIAVAAICAVCFAIENSFVTLSR
FTLIEGPFVFFMACAVYFFRRSELYLPNSCKANKSLLAASIALGFAVSSKWAGLFTIAWA
GIIVLWRVWFMIGDLSRPIGSSIKYMAFQFTCLLAIPAFIYFLIFSVHIKTLNVNGISSS
FFPAEFRKTLKYNNVIKETVAEVAVGSAVSLNHVGTAGGYLHSHLHNYPAGSMQQQVTLY
PHIDQNNKWIIELAEHPNENVTSFQNLTDGTIIKLRQLKNGCRLHSHDHKPPVSQNADWQ
KEVSCYGYEGFEGDINDDWIIEIDKKRSEPGPAQEHIRAIETKFRLKHYLTGCYLFSHPE
KLPEWGFGQQEVTCAYFAREDLTSWYIEENENEISLPNPEKVSYKKMSFWQKFVAIHKFM
FYLNNYMDTSHAYSSEPKTWPLMLRGIDFWNENGREVYFLGNAVLWWSVTAFICTFIIGV
AVELLAWKLGVNILRDKHIINFHYQVFQYLLGFAAHYFPYFFVGQKLFLYDYLPAYYFGI
LAFGHALDLISTYISNKRNNTGYIVVAIFMVVCFYFFSEHSPLIYATGWSSNLCKRSKWL
GSWDFYCNSLLLSDSHYELNAES
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagagcatttgctgaaggtggatcccatccccgatgtgactattaaacgcggc
cctttgaggtcttttctcataacaaaaccctgtgataatttgagttcattacgaacagtt
acttcatctaaggaaaagcttctagttggctgtttgctgatatttactgccatcgtaagg
ctacacaatatctccctgccaaatagtgttgtttttggtgaaaatgaagttggtacattt
gtttctcaatacgtgaacaacatattcttcaccgatgttcatcctcctttagtggcaatg
ctatatgcaaccgtgtcctctgtttttggttataaagggcttttcaattatgggaacatt
ggtactgaatacacggcaaacgttccatacgtcgcgatgaggttcttttctgctactttg
ggcatcgtgtccgttttggtattatacttaacgttacgagtttctggcgtgaaaattgcg
gtagctgccatttgtgcagtatgttttgcaattgaaaactcctttgtaacgttgtctcgt
ttcaccttgatagagggaccctttgtttttttcatggcatgtgcagtttatttctttaga
agatcggaactttatttgccaaattcatgtaaagcaaacaagtcattacttgctgcgagc
attgcattgggatttgcagtttcttcaaaatgggctggcctcttcaccatcgcatgggct
ggtattattgtcctttggagagtatggttcatgattggtgatttgtcaagacccattggt
tcttctatcaaatatatggcgttccagtttacctgtctattagctattcctgccttcatc
tattttctcattttcagcgtgcatattaagacattaaacgtgaatggtattagtagtagc
ttttttcccgctgagtttagaaaaactttaaaatacaacaacgttattaaagagactgtg
gcagaagttgcagtgggttccgctgtttcactgaatcatgttggaacggcaggtggttac
ttgcattctcatcttcacaattatccggctggttccatgcaacaacaagttactttgtat
cctcacatcgaccaaaataacaaatggattattgagctggctgaacatccaaatgaaaat
gtcacaagtttccaaaatttaaccgacggtaccataattaaattaagacagcttaagaac
ggctgcaggttacactcacatgaccacaaacctccagtttctcaaaatgcggattggcaa
aaagaggtgtcatgttatggatacgagggcttcgaaggtgatataaatgatgattggata
attgaaatcgataaaaagagatcagagccgggacctgcccaggaacatattagggctatt
gaaaccaaatttaggctgaagcattatctaactggttgttacttattttcacatcctgaa
aagctacctgagtggggattcgggcagcaggaagttacgtgtgcatactttgcaagggaa
gacttaacttcatggtatattgaagaaaacgaaaacgaaatttctttgccaaatccagag
aaggtttcttataagaaaatgagcttttggcagaagtttgttgctatccacaagttcatg
ttctaccttaacaattatatggatactagtcatgcctactcatctgaaccaaagacttgg
cctcttatgttgcgtggtattgatttttggaatgaaaatggcagagaggtgtacttttta
ggtaacgctgttttgtggtggtctgtcacagcatttatttgcacgttcatcattggagtg
gctgttgagcttcttgcttggaaattaggtgtgaatattctacgggataagcacatcata
aatttccactatcaggtctttcagtacttattaggctttgccgcccactatttcccttac
ttctttgtggggcaaaagttatttttgtacgattatttgccggcctattattttggtatc
ctagcatttggtcatgctttagacctgatttcaacctatatttctaacaaaagaaacaat
actggatatatagtggtggctattttcatggttgtatgtttctatttcttcagcgagcat
tctccacttatttatgctactggatggtcgagtaacctgtgtaagaggtccaagtggtta
ggaagctgggacttttattgcaattcactattactatccgatagccactatgaattaaac
gctgaatcatga

DBGET integrated database retrieval system