KEGG   Saccharomyces cerevisiae (budding yeast): YDL095WHelp
Entry
YDL095W           CDS       T00005                                 

Gene name
PMT1
Definition
(RefSeq) dolichyl-phosphate-mannose-protein mannosyltransferase PMT1
  KO
K00728  dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00514  Other types of O-glycan biosynthesis
sce00515  Mannose type O-glycan biosynthesis
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    YDL095W (PMT1)
   00514 Other types of O-glycan biosynthesis
    YDL095W (PMT1)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     YDL095W (PMT1)
Glycosyltransferases [BR:sce01003]
 O-Glycan biosynthesis
  O-linked Man type
   YDL095W (PMT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMT PMT_4TMC MIR
Motif
Other DBs
NCBI-GeneID: 851462
NCBI-ProteinID: NP_010188
SGD: S000002253
UniProt: P33775
Position
IV:287059..289512
Genome map
AA seq 817 aa AA seqDB search
MSEEKTYKRVEQDDPVPELDIKQGPVRPFIVTDPSAELASLRTMVTLKEKLLVACLAVFT
AVIRLHGLAWPDSVVFDEVHFGGFASQYIRGTYFMDVHPPLAKMLYAGVASLGGFQGDFD
FENIGDSFPSTTPYVLMRFFSASLGALTVILMYMTLRYSGVRMWVALMSAICFAVENSYV
TISRYILLDAPLMFFIAAAVYSFKKYEMYPANSLNAYKSLLATGIALGMASSSKWVGLFT
VTWVGLLCIWRLWFMIGDLTKSSKSIFKVAFAKLAFLLGVPFALYLVFFYIHFQSLTLDG
DGASFFSPEFRSTLKNNKIPQNVVADVGIGSIISLRHLSTMGGYLHSHSHNYPAGSEQQQ
STLYPHMDANNDWLLELYNAPGESLTTFQNLTDGTKVRLFHTVTRCRLHSHDHKPPVSES
SDWQKEVSCYGYSGFDGDANDDWVVEIDKKNSAPGVAQERVIALDTKFRLRHAMTGCYLF
SHEVKLPAWGFEQQEVTCASSGRHDLTLWYVENNSNPLLPEDTKRISYKPASFISKFIES
HKKMWHINKNLVEPHVYESQPTSWPFLLRGISYWGENNRNVYLLGNAIVWWAVTAFIGIF
GLIVITELFSWQLGKPILKDSKVVNFHVQVIHYLLGFAVHYAPSFLMQRQMFLHHYLPAY
YFGILALGHALDIIVSYVFRSKRQMGYAVVITFLAASVYFFKSFSPIIYGTPWTQELCQK
SQWLSGWDYNCNTYFSSLEEYKNQTLTKRESQPAATSTVEEITIEGDGPSYEDLMNEDGK
KIFKDTEGNELDPEVVKKMLEEEGANILKVEKRAVLE
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaagagaaaacgtacaaacgtgtagagcaggatgatcccgtgcccgaactggat
atcaagcagggccccgtaagaccctttattgttaccgatccgagtgccgaattggcctcg
ttacgaaccatggtcactcttaaagagaagctgttagtggcctgtcttgctgtctttaca
gcggtcattagattgcatggcttggcatggcctgacagcgtggtgtttgatgaagtacat
ttcggtgggtttgcctcgcaatacattagggggacttacttcatggatgtgcatcctcct
cttgcaaagatgttgtatgctggtgtggcatcgcttggtgggttccagggtgattttgac
ttcgaaaatattggtgacagctttccatctacgacgccatacgtgttgatgagatttttc
tctgcttctttgggggctcttactgttattttgatgtacatgactttacgttattctggt
gttcgtatgtgggttgctttgatgagcgctatctgctttgccgttgaaaactcgtacgtc
actatttctcgttacattctgttggacgccccattgatgtttttcattgcagctgcagtc
tactctttcaagaaatacgaaatgtaccctgccaactcgctcaatgcttacaagtccttg
cttgctactggtattgctcttggtatggcatcttcatccaaatgggttggtcttttcacg
gttacatgggtgggtcttttatgtatctggagactatggttcatgattggggatttgact
aagtcttccaagtccatcttcaaagtagcatttgccaaattggccttcttgttgggtgtg
ccttttgccctttatctggtcttcttttatatccacttccaatcattaactttggacggg
gatggcgcaagcttcttttcgcctgaatttagatctacactaaagaacaataagatcccc
caaaatgtcgttgctgatgtcggcattggctccattatcagcttgcgtcatctctctacc
atgggcggttatttgcattctcattcacacaattatccagctggttcggaacaacaacaa
agcactttatatcctcacatggatgccaataacgattggttgttggaactttacaacgca
cccggcgaatctttaacaacattccaaaacctaaccgatggtaccaaggtcagactattc
cacactgttacaagatgtagattacactctcatgaccataagccacccgtttcagaaagc
agcgactggcagaaggaggtttcttgttatggttacagcggattcgacggtgatgctaat
gatgactgggttgttgagattgataaaaagaattctgctcctggagttgcccaagaacgg
gtcatagctttggacacaaagtttagattgagacatgctatgacaggctgttatttgttt
tcccacgaagtcaagttgccagcttgggggttcgaacaacaagaagttacctgtgcctcc
tccggtagacatgatttaacattgtggtacgttgagaacaacagtaacccattgttacca
gaagataccaagcgtatttcctataaacctgcaagcttcatttctaaatttattgaatcc
cataaaaagatgtggcatatcaataaaaatttggtcgaacctcatgtttatgaatcacaa
ccaacttcatggccattcttgctacgtggtataagttactggggtgaaaataacagaaac
gtctatctattaggtaatgcgatcgtatggtgggctgtcaccgctttcatcggtattttc
ggattgattgttatcactgagctgttctcgtggcagttaggtaaaccaattttgaaggac
tccaaggttgttaacttccacgttcaggttattcactacttattgggttttgccgtccat
tatgctccatctttcttaatgcaacgtcaaatgtttttgcatcactacttacctgcttat
tatttcggtattcttgcccttggccacgccttggacataatagtttcttatgttttccgc
agcaagagacaaatgggctacgcggtagtgatcactttccttgctgcttctgtgtatttc
ttcaagagcttcagtccaattatttacggtacaccatggactcaagaattgtgtcaaaaa
tcgcagtggttgtctggttgggactacaattgtaacacatacttttcttcattagaagag
tacaaaaaccaaaccttgactaaacgtgaatctcaacctgccgccactagtacagttgaa
gaaatcactatagaaggggacggtccgtcgtatgaagatctcatgaacgaggatggcaag
aaaatctttaaagacacagaaggtaatgaactagatccagaagttgtcaaaaaaatgttg
gaagaggagggagctaacattttaaaagtagaaaaaagggctgttttggaataa

DBGET integrated database retrieval system