KEGG   Saccharomyces cerevisiae (budding yeast): YDL106CHelp
Entry
YDL106C           CDS       T00005                                 

Gene name
PHO2, BAS2, GRF10
Definition
Pho2p
Orthology
K02646  
regulatory protein PHO2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YDL106C (PHO2)
Transcription factors [BR:sce03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, not assigned
    YDL106C (PHO2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:complement(270222..271901)
Genome map
AA seq 559 aa AA seqDB search
MMEEFSYDHDFNTHFATDLDYLQHDQQQQQQQQHDQQHNQQQQPQPQPIQTQNLEHDHDQ
HTNDMSASSNASDSGPQRPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKN
VRIWFQNRRAKLRKKQHGSNKDTIPSSQSRDIANDYDRGSTDNNLVTTTSTSSIFHDEDL
TFFDRIPLNSNNNYYFFDICSITVGSWNRMKSGALQRRNFQSIKELRNLSPIKINNIMSN
ATDLMVLISKKNSEINYFFSAMANNTKILFRIFFPLSSVTNCSLTLETDDDIINSNNTSD
KNNSNTNNDDDNDDNSNEDNDNSSEDKRNAKDNFGELKLTVTRSPTFAVYFLNNAPDEDP
NLNNQWSICDDFSEGRQVNDAFVGGSNIPHTLKGLQKSLRFMNSLILDYKSSNEILPTIN
TAIPTAAVPQQNIAPPFLNTNSSATDSNPNTNLEDSLFFDHDLLSSSITNTNNGQGSNNG
RQASKDDTLNLLDTTVNSNNNHNANNEENHLAQEHLSNDADIVANPNDHLLSLPTDSELP
NTPDFLKNTNELTDEHRWI
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgatggaagaattctcgtacgatcacgattttaacacacattttgctacagatttggat
tatttgcaacatgaccaacaacaacaacaacagcaacaacatgatcaacaacataatcaa
cagcaacaaccacaaccacaaccaattcaaactcaaaacctggagcacgaccacgaccaa
catactaatgatatgagtgcttcatcgaatgcatcagatagtggacctcaaaggcccaag
aggactcgcgcaaagggtgaagcactagatgtgctaaagcgtaaatttgaaataaatcca
acaccctctttggtagaaagaaagaaaatatcagatctgataggaatgcctgaaaaaaac
gtcagaatttggtttcagaacagaagagctaaattgaggaaaaagcagcatggaagtaat
aaggacacaatcccctcgtcacaatcccgtgatattgccaacgattacgatcgtgggagt
acagacaacaatttggtcactacaacaagtacttcatccatatttcacgatgaagacctg
acttttttcgaccgtattccgctgaacagcaacaacaactattatttttttgacatttgc
tcaattactgtgggaagttggaatagaatgaaaagcggcgcactgcaaagaaggaacttt
cagtctataaaggagttgagaaacctatcgccaataaagattaataacataatgtcgaat
gccacagatttaatggttttgatatccaagaaaaactcagaaataaactatttttttagt
gccatggcaaataatactaaaattctcttcaggatctttttcccattaagttcagtcacg
aattgctctctaactttagaaactgacgacgatataataaatagtaacaacacaagcgat
aaaaacaatagtaatactaataatgatgatgataacgacgataacagtaatgaagacaat
gataatagtagtgaggataagaggaatgctaaggataactttggagaattgaagctaaca
gtcaccagatcacccacttttgctgtttactttttaaataatgctcctgatgaagatcca
aatttgaacaatcagtggtccatatgtgatgatttctcagaaggtagacaggtaaatgac
gcatttgttggtggttcgaatattcctcacactttgaaaggtttacagaaatcattaaga
ttcatgaattctctaattctagactataaatcatcgaatgaaatattacctacgatcaat
acagcgatccccactgctgcagttccacaacagaatattgcccctccctttctgaataca
aattcaagtgcaacagactcaaatccaaatacaaatttagaagattctctcttcttcgat
catgatctgttatcgagttcgataaccaacaccaacaacggacaaggctctaataatgga
cgtcaagctagcaaggatgatacgctcaatttactggatactaccgtcaacagcaataac
aatcataatgctaataatgaggagaatcatctagcgcaagaacatttatccaacgatgct
gatattgttgcaaatccaaatgatcatttgttgtctttaccgactgatagtgaactccca
aatactccagattttttgaagaacactaacgaactaactgacgagcatagatggatatga

DBGET integrated database retrieval system