KEGG   Saccharomyces cerevisiae (budding yeast): YDL127WHelp
Entry
YDL127W           CDS       T00005                                 

Gene name
PCL2, CLN4
Definition
Pcl2p
Orthology
K06657  
G1/S-specific cyclin PLC2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YDL127W (PCL2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:234927..235853
Genome map
AA seq 308 aa AA seqDB search
MSNYEALLKFNRKAVSKEMVQYLASTTASIIKIKKTNSMIDIALPAPPLTKFINRLIKHS
NVQTPTLMATSVYLAKLRSIIPSNVYGIETTRHRIFLGCLILAAKTLNDSSPLNKHWAEY
TDGLLILREVNTIERELLEYFDWDVTISTDDLITCLSPFLKPIKEEQLYKSQRDCRTLKN
FSAQEKDIVNKTSISHSRSSSNMSIPSLASTSTLSTLESRRSNLSNYSNRIRTLPELHES
NNISDKFSPRTYNIDSKHDNKENRPIPTIKPFNFSKARPVILKTGLNKQIIKEDTKVKKS
NWSNYFKS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaactacgaagccttgctgaaattcaataggaaggctgtatctaaggaaatggtg
caatatctagcatcgaccacagcttccattatcaaaattaagaagacgaatagtatgata
gatattgcattgccagcaccaccgttgactaaattcatcaacagactgatcaagcattct
aacgttcaaactccgactctgatggctacctctgtatatttggccaaattaagatcaata
ataccgagtaacgtttatggtatagagaccaccaggcatagaatattcttaggttgccta
atattagctgcaaaaacgttaaatgattcctcccctcttaacaaacactgggccgaatat
acggacggccttctcatcctaagggaggttaatactattgaaagggaactattagaatat
tttgattgggacgtcaccatttccacagatgatttaattacatgtctctcgccattcttg
aagcctatcaaagaggagcagttgtacaaatcgcaaagagactgtcgcacgttgaaaaat
ttttctgctcaagaaaaagacatagtaaacaaaacatccatttcccattcgcgctcatcg
tccaatatgtctatcccatctttagcttccacttcgaccctctccacgttggaatctaga
agatcgaatttatccaattatagtaacagaatacgaactttgcccgaactacacgaatcc
aataacattagcgacaagttttctccgcgaacatacaacatagactccaaacacgataac
aaggaaaataggccaataccgacaattaagccttttaattttagtaaagcgcgccctgtg
atcttgaaaactgggttaaacaaacagataataaaagaagatacaaaagtaaagaaatcg
aattggtcaaattacttcaaatcgtga

DBGET integrated database retrieval system