KEGG   Saccharomyces cerevisiae (budding yeast): YDL128WHelp
Entry
YDL128W           CDS       T00005                                 

Gene name
VCX1, HUM1, MNR1
Definition
(RefSeq) Vcx1p
  KO
K07300  
Ca2+:H+ antiporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Transporters [BR:sce02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   YDL128W (VCX1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
SGD: 
UniProt: 
Structure
PDB: 

Jmol
Position
IV:232652..233887
Genome map
AA seq 411 aa AA seqDB search
MDATTPLLTVANSHPARNPKHTAWRAAVYDLQYILKASPLNFLLVFVPLGLIWGHFQLSH
TLTFLFNFLAIIPLAAILANATEELADKAGNTIGGLLNATFGNAVELIVSIIALKKGQVR
IVQASMLGSLLSNLLLVLGLCFIFGGYNRVQQTFNQTAAQTMSSLLAIACASLLIPAAFR
ATLPHGKEDHFIDGKILELSRGTSIVILIVYVLFLYFQLGSHHALFEQQEEETDEVMSTI
SRNPHHSLSVKSSLVILLGTTVIISFCADFLVGTIDNVVESTGLSKTFIGLIVIPIVGNA
AEHVTSVLVAMKDKMDLALGVAIGSSLQVALFVTPFMVLVGWMIDVPMTLNFSTFETATL
FIAVFLSNYLILDGESNWLEGVMSLAMYILIAMAFFYYPDEKTLDSIGNSL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaactaccccactattaactgttgcgaacagtcatcccgcccgcaatccaaag
cacactgcatggagagcagctgtgtatgatttacagtatattttgaaagcgtcacccctg
aatttcctattggtatttgttcctttaggtctgatttggggacacttccaactatctcat
acactgacatttctttttaatttcttggcaattataccgttggcagctatcttggctaat
gccacggaagagttggctgataaggctggtaacaccattgggggactgctaaatgctact
tttggtaacgctgtggaactaattgtttctatcattgccctgaaaaaaggtcaagtgaga
attgtgcaggcctcgatgctaggtagtcttctttctaatttgctgttagtgcttggatta
tgcttcatattcggtggatacaatagagtccaacagacattcaaccaaaccgccgctcaa
acaatgtcctcattacttgccattgcgtgtgcatccctactgattcccgctgcctttaga
gccaccctacctcatggcaaggaagaccacttcatcgatggaaaaatattggagttatcc
agaggcacctctattgttattctcatcgtttacgttttgttcttatatttccagctaggg
agccatcacgccttgtttgagcaacaagaagaagagaccgatgaagttatgagcaccatt
tccaggaatccacatcactctttgagtgtcaagtcatcattggtgatacttctaggtaca
actgtgatcatctctttttgtgcggattttctagtcggtacgatagacaacgttgttgaa
tctaccgggctatctaaaacatttataggtttgattgtcattcctattgtgggtaatgcc
gcagagcatgtcacttcagtcttggtggccatgaaggataagatggatctggcgctaggt
gttgccatcggttcctctttacaagttgccttatttgttacaccattcatggttcttgtg
ggctggatgatcgatgttccaatgacgctaaatttctccacttttgaaaccgctactctt
tttattgctgttttcttatccaattacttaattctcgatggtgagtcaaactggttggag
ggtgtcatgtctctagctatgtatattttgattgcaatggcatttttctattatccagac
gaaaaaacccttgactctattggaaatagtttatga

DBGET integrated database retrieval system