KEGG   Saccharomyces cerevisiae (budding yeast): YDL132WHelp
Entry
YDL132W           CDS       T00005                                 

Gene name
CDC53
Definition
cullin CDC53
Orthology
K03347  
cullin 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Module
SCF-MET30 complex
SCF-CDC4 complex
SCF-GRR1 complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YDL132W (CDC53)
   04120 Ubiquitin mediated proteolysis
    YDL132W (CDC53)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YDL132W (CDC53)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   SCF complex
    Cullin
     YDL132W (CDC53)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
IV:224304..226751
Genome map
AA seq 815 aa AA seqDB search
MSETLPRSDDLEATWNFIEPGINQILGNEKNQASTSKRVYKILSPTMYMEVYTAIYNYCV
NKSRSSGHFSTDSRTGQSTILVGSEIYEKLKNYLKNYILNFKQSNSETFLQFYVKRWKRF
TIGAIFLNHAFDYMNRYWVQKERSDGKRHIFDVNTLCLMTWKEVMFDPSKDVLINELLDQ
VTLGREGQIIQRSNISTAIKSLVALGIDPQDLKKLNLNVYIQVFEKPFLKKTQEYYTQYT
NDYLEKHSVTEYIFEAHEIIKREEKAMTIYWDDHTKKPLSMALNKVLITDHIEKLENEFV
VLLDARDIEKITSLYALIRRDFTLIPRMASVFENYVKKTGENEISSLLAMHKHNIMKNEN
ANPKKLALMTAHSLSPKDYIKKLLEVHDIFSKIFNESFPDDIPLAKALDNACGAFININE
FALPAGSPKSATSKTSEMLAKYSDILLKKATKPEVASDMSDEDIITIFKYLTDKDAFETH
YRRLFAKRLIHGTSTSAEDEENIIQRLQAANSMEYTGKITKMFQDIRLSKILEDDFAVAL
KNEPDYSKAKYPDLQPFVLAENMWPFSYQEVEFKLPKELVPSHEKLKESYSQKHNGRILK
WLWPLCRGELKADIGKPGRMPFNFTVTLFQMAILLLYNDADVLTLENIQEGTSLTIQHIA
AAMVPFIKFKLIQQVPPGLDALVKPETQFKLSRPYKALKTNINFASGVKNDILQSLSGGG
HDNHGNKLGNKRLTEDERIEKELNTERQIFLEACIVRIMKAKRNLPHTTLVNECIAQSHQ
RFNAKVSMVKRAIDSLIQKGYLQRGDDGESYAYLA
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagactctgcctagatctgatgatttagaggccacttggaactttatagagcca
ggaattaaccaaatactgggtaatgagaaaaaccaagcatccacgtctaagcgagtttac
aaaattctttctccaaccatgtatatggaagtctataccgcaatttataactactgtgtg
aacaaatcacgctcgtctggacattttagtactgacagtagaactggccaatcaacaatt
ttggttggcagtgagatttacgaaaagttaaagaattatttgaagaattacattttaaat
tttaagcagtctaattcagagacctttttgcagttttacgtcaagcgctggaaaaggttt
acaataggtgccatttttttaaaccatgcattcgattatatgaatagatattgggttcaa
aaggaaagaagtgacggcaaaaggcatatttttgatgtaaacaccttgtgcttgatgaca
tggaaagaagtcatgtttgatccgagtaaagatgttttaataaacgaattattagaccag
gtaaccttgggaagggaggggcaaataattcaaagaagtaatattagcactgccataaag
tctttagttgcactaggtatcgatccacaggatttgaaaaagttgaacctaaatgtctac
atccaagttttcgaaaagccatttttaaagaagactcaggagtactacacgcaatataca
aacgattatttagagaaacactcggtaactgagtatatttttgaagcacatgaaatcatc
aaacgtgaggaaaaagcaatgacaatatattgggatgatcatacaaaaaaaccactatcc
atggcattaaacaaggtcttgatcacagaccatattgaaaagttggaaaatgagtttgtt
gtccttctggatgccagagatattgaaaaaattacttctttgtacgcactaatacgcaga
gactttacattaatcccaagaatggcttcagtgtttgaaaattatgttaaaaagacaggt
gagaatgaaatttcgagtctactggcaatgcataaacacaatattatgaaaaacgaaaac
gcaaaccctaaaaaactagcactaatgacagctcactccctttctcctaaagactatatc
aagaaattactggaagtacacgatatattctctaagatttttaatgaaagtttccccgac
gacatacctttagctaaagctctagataatgcgtgtggtgctttcatcaacatcaacgag
ttcgcattacctgctggatctccaaaaagtgccacctcgaagacttccgagatgctagct
aagtacagtgatatactattaaagaaggccaccaaacctgaagtggcaagtgacatgtca
gatgaagatattataacaatattcaaatatttgaccgacaaagatgcgttcgaaactcat
tatagaagacttttcgccaagcgtttaattcatggcacttcaacatcagcagaagacgaa
gaaaatattattcaaaggctgcaagcggcaaatagtatggaatatacaggcaagataact
aaaatgtttcaagatattagactttccaagatcttggaagacgattttgctgtcgccctg
aagaatgaaccagattactctaaagcaaaatatccagatctacaaccatttgtattggca
gaaaatatgtggccattttcataccaagaagttgaatttaagctacccaaggaattggta
ccatctcacgaaaaattgaaggagtcatacagccaaaagcataatggtagaatattgaag
tggctatggccattatgtcgtggcgaattgaaggcagatattggaaaacccggcaggatg
ccgttcaactttacggtaacactgtttcaaatggcaattttgctactatataacgatgct
gatgtattaaccttagaaaatattcaagagggcacgagcttaaccattcagcacatcgca
gcggcaatggtaccattcatcaaattcaaactgattcaacaggtcccaccagggctagat
gctctcgtgaaacctgaaacacaattcaagctatcacgtccttataaggcgcttaagacc
aatattaatttcgctagcggagtcaaaaacgacattctgcaatcgctatccggtggaggc
cacgataatcacggtaataagttaggaaacaaacgcttgacggaagacgaaagaatagaa
aaagaattgaatacagaaaggcagattttcttggaagcttgtattgtgagaataatgaaa
gcgaaaagaaatctgccacatacaacattggtcaacgaatgcattgcgcaatcacaccaa
aggttcaatgcaaaggtttctatggtcaagagagccatcgatagcttaatacaaaaggga
tacctacagaggggagacgatggtgaatcgtatgcttaccttgcttaa

DBGET integrated database retrieval system