KEGG   Saccharomyces cerevisiae (budding yeast): YDL134CHelp
Entry
YDL134C           CDS       T00005                                 

Gene name
PPH21, PPH1
Definition
Pph21p (EC:3.1.3.16)
Orthology
K04382  
serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
mRNA surveillance pathway
Cell cycle - yeast
Meiosis - yeast
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:sce03015]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:sce04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:complement(219662..220771)
Genome map
AA seq 369 aa AA seqDB search
MDTDLDVPMQDAVTEQLTPTVSEDMDLNNNSSDNNAEEFSVDDLKPGSSGIADHKSSKPL
ELNNTNINQLDQWIEHLSKCEPLSEDDVARLCKMAVDVLQFEENVKPINVPVTICGDVHG
QFHDLLELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGNHES
RQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPITALVDNKIFCLHGGLSPMIETIDQV
RELNRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGFTFGQDVSEQFNHTNDLSLIARA
HQLVMEGYAWSHQQNVVTIFSAPNYCYRCGNQAAIMEVDENHNRQFLQYDPSVRPGEPSV
SRKTPDYFL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggatacagatttagatgtgcctatgcaagatgctgttaccgaacagctgactcccaca
gtatctgaagatatggatctcaacaacaattcatcggataataatgcagaagaattctcg
gttgatgatttaaaacctggttcctcgggcatagcagatcacaaatcttccaaaccacta
gaactgaataacacaaatataaatcagcttgaccaatggattgagcatttgagtaaatgc
gagccactatcagaagacgatgtagcacgactatgtaaaatggcggtggacgtgttgcag
ttcgaggagaatgttaaaccaattaacgtgcctgttaccatttgtggtgacgtacacggt
caattccatgacttgttagaactttttaagattggtggcccttgtcctgacaccaattac
cttttcatgggtgattacgtggatagaggatattattctgttgaaactgtatcttaccta
gttgccatgaaagtcagatacccacatagaattacgatactgagaggcaatcacgagtct
aggcagattacccaagtatacgggttttatgatgaatgtttgagaaagtacggcagtgca
aacgtgtggaaaatgttcacagatcttttcgattattttcctataaccgcattagtagat
aataaaattttctgtctgcatggaggactttcccccatgatagaaaccatagatcaggtg
agagagttgaacagaatacaggaagtgcctcatgaaggtcctatgtgtgaccttctatgg
tcagaccctgacgatagaggcggatggggaatcagtcccagaggtgcaggcttcactttt
ggacaagatgtcagtgagcaattcaatcacactaatgatctatcactaatagcaagagct
caccaattggtaatggaaggctatgcttggtctcaccagcaaaatgttgtcaccattttc
agtgctcctaattactgctacagatgtggtaatcaagcagctatcatggaagtggacgag
aatcataatagacaattcttacagtacgacccatccgtaagaccaggtgaacctagcgtc
agcagaaagacgccagattactttttatga

DBGET integrated database retrieval system