KEGG   Saccharomyces cerevisiae (budding yeast): YDL155WHelp
Entry
YDL155W           CDS       T00005                                 

Gene name
CLB3
Definition
Clb3p
Orthology
K06659  
G2/mitotic-specific cyclin 3/4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YDL155W (CLB3)
   04113 Meiosis - yeast
    YDL155W (CLB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:176773..178056
Genome map
AA seq 427 aa AA seqDB search
MHHNSQSLSSGHIRSPEDENVAPIGNLKHRTGSLSHISSAHPRVALSDVTNIVATNSSNN
SISKPKVAPIKERLDSAAIIEEERLDANSVAQRKEADHNDLLTDREQEEPVEDDGESEED
EEEDQEPLLLQHYASDTLVWEHAFRTYYRTTLDPNDDDVYDVVMVAELSNEIFEYMRKLE
DLYKPNPYYMDKQPELRWSFRSTLIDWIVQVHEKFQLLPETLYLCINIIDRYLCKEVVPV
NKFQLVGAASLFIAAKYEEINCPTIKDFVYMSENCYSRNDLLDAERTILNGLEFELGWPG
PMSFLRRISKADDYEHDTRTLAKYLLESTIMDHRLVSAQPSWLAAGAYFLSKIILGQNQW
SLAHVYYSNYTQEQILPLATIILENCRYASKRHNAIWRKYSSRRYLHSSQIVAKWIALAE
HRVERSN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcatcataactcacagtctttgagctctggacacatcaggagccccgaggatgaaaat
gtggcacctataggtaatcttaaacacaggactggatccctcagtcatatttcatctgcg
cacccgagggtcgcacttagcgacgttaccaatatagttgcgacaaactctagcaacaac
agcataagtaagccaaaagtcgccccaattaaagaaagattggattcagctgcgataatt
gaggaagaaaggctggatgcgaatagtgttgcacagagaaaagaagctgatcataacgat
ttgttaacggacagggaacaagaggaacccgttgaagacgacggagaaagcgaagaggat
gaagaagaagaccaggagcctctactgttgcaacattatgctagtgatacattggtctgg
gagcatgcatttagaacttactatagaactacattagatcccaatgatgatgacgtgtac
gatgtggtcatggttgccgaattatctaatgagatattcgagtatatgaggaaattggaa
gacctgtataaacccaacccgtactacatggataaacaaccagagttaagatggtcgttt
cgaagcacactgattgattggatcgtccaagtacatgaaaaatttcaacttttacctgaa
actctatatctctgcattaatataatagacagatatctgtgcaaagaagttgttcctgta
aataagttccaacttgtgggtgcagcctcactcttcattgctgctaaatatgaggaaatc
aactgtcctacaatcaaggatttcgtatacatgtcagaaaactgctactcaaggaacgac
ctgctggacgcagaaagaactattttgaacggcttagaatttgaattgggttggcctggt
ccgatgtcatttttacgaagaatcagtaaggcagacgattacgagcatgatacgagaaca
ctggccaaatatctattggaatccacaataatggaccatcgactggtttccgctcaacct
agttggttagctgccggtgcatactttctaagtaagattattctgggccaaaatcagtgg
tctctggcgcacgtctactattccaattatacacaagaacaaattcttccgttggccacc
attattttagaaaattgcagatatgcctctaaacgtcataacgccatatggagaaaatat
tcttcacgtcgttatttgcattcttcacagatcgtagcgaagtggatagcattagctgaa
cacagagtagaaagatctaactaa

DBGET integrated database retrieval system