KEGG   Saccharomyces cerevisiae (budding yeast): YDL159WHelp
Entry
YDL159W           CDS       T00005                                 

Gene name
STE7
Definition
Ste7p (EC:2.7.12.2)
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:sce04011]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:172481..174028
Genome map
AA seq 515 aa AA seqDB search
MFQRKTLQRRNLKGLNLNLHPDVGNNGQLQEKTETHQGQSRIEGHVMSNINAIQNNSNLF
LRRGIKKKLTLDAFGDDQAISKPNTVVIQQPQNEPVLVLSSLSQSPCVSSSSSLSTPCII
DAYSNNFGLSPSSTNSTPSTIQGLSNIATPVENEHSISLPPLEESLSPAAADLKDTLSGT
SNGNYIQLQDLVQLGKIGAGNSGTVVKALHVPDSKIVAKKTIPVEQNNSTIINQLVRELS
IVKNVKPHENIITFYGAYYNQHINNEIIILMEYSDCGSLDKILSVYKRFVQRGTVSSKKT
WFNELTISKIAYGVLNGLDHLYRQYKIIHRDIKPSNVLINSKGQIKLCDFGVSKKLINSI
ADTFVGTSTYMSPERIQGNVYSIKGDVWSLGLMIIELVTGEFPLGGHNDTPDGILDLLQR
IVNEPSPRLPKDRIYSKEMTDFVNRCCIKNERERSSIHELLHHDLIMKYVSPSKDDKFRH
WCRKIKSKIKEDKRIKREALDRAKLEKKQSERSTH
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaacgaaagactttacagagaaggaacttgaaagggctcaatcttaacctgcac
ccagatgtgggcaataatggccaattgcaggaaaagacagagactcaccagggacaatct
cgaatagaaggccacgtgatgtctaacattaatgcaatacagaataatagcaacctgttt
ttgcgaagaggcataaaaaaaaaactgacgttggatgcgtttggtgatgaccaagctata
tcgaaaccaaacactgtggtaatacagcaaccgcaaaatgaacctgttttagttctgtct
tctctatcacaatccccgtgtgtatcatcatcatcatctttgtccacgccatgcattata
gatgcgtacagtaataatttcggattatcgccatcatccacgaattctactccctctacg
attcagggattgtccaatattgcaacaccagttgaaaacgaacattcgatatcactacca
cctttggaggaaagcctatcgccagccgcagcagatctgaaagatacgttgtcgggaact
tcaaatggtaattatatacaactccaggacttggttcagttggggaaaattggtgctgga
aattctggaactgtggtgaaggcactacatgttcctgattccaaaatagttgccaaaaaa
accattcctgtggaacagaataacagtacaatcatcaaccaattagttagggaattatct
atcgtcaaaaacgttaagccccatgaaaacattatcaccttctatggagcttattataac
cagcatataaataatgaaatcataattttaatggaatactctgattgtggttctttagat
aaaatactgtccgtttataaaaggtttgttcaaagagggactgtttcgagtaagaaaacc
tggttcaacgaattaacaatatcaaaaatagcgtatggcgtactaaatggcttggatcat
ttgtaccgacaatataagatcattcatcgtgatatcaagccttccaatgttctgattaat
agtaaggggcagattaagttatgtgattttggagtttccaaaaaactaataaattctatc
gctgatacatttgttggaacgtccacttatatgtcaccagagaggatacaaggaaacgtt
tattctatcaaaggggacgtttggtcattgggcttaatgatcatcgagctggtaactgga
gagtttcccctaggtgggcataacgatacacctgatggcatattggatttgctgcaacgt
attgtcaacgagccttcaccaagattacccaaagaccgtatctattccaaggaaatgaca
gattttgtcaataggtgttgtattaagaatgaaagggaaaggtcatcgattcatgaattg
ctacatcatgatcttataatgaaatacgtatcaccgtctaaagatgataaatttagacat
tggtgtagaaaaataaaatctaaaataaaggaagacaagagaattaaaagagaagccttg
gaccgtgccaagttagaaaagaaacaatcggaaagatcaacccattga

DBGET integrated database retrieval system