KEGG   Saccharomyces cerevisiae (budding yeast): YDL188CHelp
Entry
YDL188C           CDS       T00005                                 

Gene name
PPH22, PPH2
Definition
Pph22p (EC:3.1.3.16)
Orthology
K04382  
serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
mRNA surveillance pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    YDL188C (PPH22)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YDL188C (PPH22)
   04113 Meiosis - yeast
    YDL188C (PPH22)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     YDL188C (PPH22)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     YDL188C (PPH22)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YDL188C (PPH22)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:complement(123865..124998)
Genome map
AA seq 377 aa AA seqDB search
MDMEIDDPMHGSDEDQLSPTLDEDMNSDDGKNNTKARSNDEDTDEELEDFNFKPGSSGIA
DHKSSKPLKLTNTNINQLDQWIEHLSKCEPLSEDDVARLCKMAVDVLQFEENVKPINVPV
TICGDVHGQFHDLLELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRIT
ILRGNHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPVTALVDNKIFCLHGGLSP
MIETIDQVRDLNRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGFTFGQDISEQFNHTN
DLSLIARAHQLVMEGYSWSHQQNVVTIFSAPNYCYRCGNQAAIMEVDENHNRQFLQYDPS
VRPGEPTVTRKTPDYFL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggatatggaaattgatgaccctatgcatggttcagatgaagatcaattatcaccgact
ctcgacgaagacatgaatagtgatgacggcaaaaataatacgaaggcgcgttctaatgac
gaagacacagatgaagagttggaagattttaattttaaaccggggtcctcgggtatagca
gatcataaatcctccaaaccactaaaactgaccaatacaaatataaatcagcttgaccaa
tggattgagcatttgagtaaatgcgagccactatcagaagacgatgtagcacgactatgt
aaaatggcggtggacgtgttgcagttcgaggagaatgttaaaccaattaacgtgcctgtt
accatttgtggtgacgtacacggtcaattccatgacttgttagaacttttcaagattggt
ggtccttgtcctgacaccaattaccttttcatgggtgattacgtggatagaggatattat
tctgttgagaccgtatcttacctagttgccatgaaagtcagatatccacatagaattact
atacttaggggcaatcacgagtctaggcagattacccaagtatatgggttttatgacgaa
tgtttgagaaagtacggcagtgcgaacgtgtggaaaatgtttaccgatctattcgattat
ttccccgttactgccttggtggataataaaatcttctgtttgcatggaggtctctcaccc
atgatagagacaatagatcaagttagagatttaaatagaatacaggaagtgcctcacgaa
ggtccaatgtgtgaccttctatggtccgatcctgatgatagaggcggatggggaatcagt
ccgagaggtgcaggcttcacttttggtcaagacatcagtgagcaattcaatcacactaat
gacctatcactaatagcaagagctcaccaattggtaatggaaggatattcttggtctcac
cagcaaaatgttgtcaccattttcagtgctccaaattattgttatagatgtggtaaccag
gccgctattatggaggtggatgaaaaccataataggcaattcttacaatacgatccatct
gtgagacccggtgaaccaaccgtcaccaggaagacaccggattatttcttataa

DBGET integrated database retrieval system