KEGG   Saccharomyces cerevisiae (budding yeast): YDL194WHelp
Entry
YDL194W           CDS       T00005                                 

Gene name
SNF3
Definition
Snf3p
Orthology
K08139  
MFS transporter, SP family, sugar:H+ symporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:sce04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:111580..114234
Genome map
AA seq 884 aa AA seqDB search
MDPNSNSSSETLRQEKQGFLDKALQRVKGIALRRNNSNKDHTTDDTTGSIRTPTSLQRQN
SDRQSNMTSVFTDDISTIDDNSILFSEPPQKQSMMMSICVGVFVAVGGFLFGYDTGLINS
ITSMNYVKSHVAPNHDSFTAQQMSILVSFLSLGTFFGALTAPFISDSYGRKPTIIFSTIF
IFSIGNSLQVGAGGITLLIVGRVISGIGIGAISAVVPLYQAEATHKSLRGAIISTYQWAI
TWGLLVSSAVSQGTHARNDASSYRIPIGLQYVWSSFLAIGMFFLPESPRYYVLKDKLDEA
AKSLSFLRGVPVHDSGLLEELVEIKATYDYEASFGSSNFIDCFISSKSRPKQTLRMFTGI
ALQAFQQFSGINFIFYYGVNFFNKTGVSNSYLVSFITYAVNVVFNVPGLFFVEFFGRRKV
LVVGGVIMTIANFIVAIVGCSLKTVAAAKVMIAFICLFIAAFSATWGGVVWVISAELYPL
GVRSKCTAICAAANWLVNFICALITPYIVDTGSHTSSLGAKIFFIWGSLNAMGVIVVYLT
VYETKGLTLEEIDELYIKSSTGVVSPKFNKDIRERALKFQYDPLQRLEDGKNTFVAKRNN
FDDETPRNDFRNTISGEIDHSPNQKEVHSIPERVDIPTSTEILESPNKSSGMTVPVSPSL
QDVPIPQTTEPAEIRTKYVDLGNGLGLNTYNRGPPSLSSDSSEDYTEDEIGGPSSQGDQS
NRSTMNDINDYMARLIHSTSTASNTTDKFSGNQSTLRYHTASSHSDTTEEDSNLMDLGNG
LALNAYNRGPPSILMNSSDEEANGGETSDNLNTAQDLAGMKERMAQFAQSYIDKRGGLEP
ETQSNILSTSLSVMADTNEHNNEILHSSEENATNQPVNENNDLK
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atggatcctaatagtaacagttctagcgaaacattacgccaagagaaacagggtttccta
gacaaagctcttcagagggtgaagggcatagcactgcgacgaaacaatagtaacaaagat
catacaacagatgatacgacaggtagcatacgaacccctacgagcttgcagcggcaaaat
tctgacaggcaatctaatatgacatccgtgtttacggatgacatttctaccatagacgac
aactcaattttattttcagagcctcctcagaaacaatctatgatgatgtctatatgcgta
ggtgtttttgttgcagttggcggatttttatttggttatgatacaggtctgatcaacagt
attacatctatgaactatgtgaagtcacacgtagcacctaatcacgattcatttaccgcc
caacaaatgtccattttggtgtcatttttgtcattgggaactttttttggggctttaact
gcaccatttatatctgattcgtatggcaggaagcctactatcattttcagtacaattttc
atcttctctatcggaaattctttacaggtaggtgctggaggaatcacattattgattgtg
ggaagggtcatttcaggtatcggtataggcgcaatttcagcggttgttccattataccaa
gcagaagctacacataaatcattaagaggtgctattatttctacttaccaatgggccatt
acctggggcttgctcgtgtcaagtgcagtgtcgcaagggacacacgcaagaaacgacgca
tcttcgtatcggattcccatagggttgcaatatgtctggtcgtcatttctcgctatcggg
atgttctttctccctgagagtccacgctattacgttttgaaagacaagctagatgaagca
gctaaatctttatcgtttttaagaggtgtaccagtccatgattctgggttactggaagaa
ctagttgaaataaaggcaacatatgattacgaggcatcttttggttcttcgaacttcatt
gattgttttatttcaagtaaaagtagaccaaagcaaactctaaggatgtttacgggaatt
gcccttcaagcatttcaacaattttcaggtatcaactttatattttactacggtgtcaat
ttcttcaataagacaggagtcagtaatagttatctggtttcatttataacctatgctgtt
aatgttgtctttaatgttcctggtttgttttttgtggaattttttggtagacgtaaggtg
ctggttgttgggggtgttatcatgactatagccaactttattgtggccattgttgggtgt
tccttaaagactgtagcggccgcaaaagttatgatagcatttatatgtctattcatagct
gccttttctgctacatggggtggtgttgtttgggttatttcagcagaactgtacccattg
ggtgtgagatctaaatgtacggctatatgcgctgctgctaactggcttgtaaactttatt
tgtgctttaattaccccttatattgtagatactgggtcgcatacatcatcattaggtgca
aaaatattcttcatttggggctccttaaatgcgatgggggtgatagttgtttacttgacc
gtttatgaaacgaagggtttgacattagaagagattgatgaattatatattaagtcatcc
actggtgtcgtgtcaccaaaatttaataaagatattagggaacgcgcacttaaattccaa
tacgatcctttgcaaagattagaagacggaaagaacacttttgttgctaaaagaaataat
tttgacgatgaaacaccaagaaatgattttcgaaatacgatatcgggcgaaatagatcat
agtcccaatcaaaaagaagttcattctatcccagaacgtgttgatattcctactagtaca
gaaattcttgaaagcccgaacaaaagtagtggtatgacagtccctgtgtcaccttctctg
caagacgttccaatcccgcaaacaacagagcctgctgaaattcgaaccaaatatgtggac
ctaggaaatgggcttggtcttaatacgtataatagagggcctccctcactctcaagcgac
tcaagcgaagattacacagaagatgaaataggcgggccctcatctcaaggcgaccaaagt
aatagaagtactatgaatgatattaatgattatatggcacgtctcattcacagtacttct
actgcaagtaacacgacagataagttctccggtaaccaaagtacccttcgttaccacacg
gcttcctcacattcggatacaactgaagaggacagcaatttgatggacctgggaaacggg
cttgccttgaatgcttataacagaggtccaccttcaattttaatgaattccagtgatgaa
gaggcaaatggtggtgagacgtctgataatttgaacacagctcaagacttggctggtatg
aaggaacgaatggcgcagtttgcgcagagctatattgacaagagaggcggtctggaacct
gaaactcaatctaatattttgagcacttctctctccgtgatggctgacactaatgaacat
aataatgaaatcctccactcaagcgaagaaaacgccactaatcaacctgtaaatgaaaat
aatgatttgaaataa

DBGET integrated database retrieval system