KEGG   Saccharomyces cerevisiae (budding yeast): YDR009WHelp
Entry
YDR009W           CDS       T00005                                 

Gene name
GAL3
Definition
transcriptional regulator GAL3
Orthology
K00849  
galactokinase [EC:2.7.1.6]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Galactose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, galactose => UDP-galactose
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sce00052]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sce00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
IV:463434..464996
Genome map
AA seq 520 aa AA seqDB search
MNTNVPIFSSPVRDLPRSFEQKHLAVVDAFFQTYHVKPDFIARSPGRVNLIGEHIDYCDF
SVLPLAIDVDMLCAVKILDEKNPSITLTNADPKFAQRKFDLPLDGSYMAIDPSVSEWSNY
FKCGLHVAHSYLKKIAPERFNNTPLVGAQIFCQSDIPTGGGLSSAFTCAAALATIRANMG
KNFDISKKDLTRITAVAEHYVGVNNGGMDQATSVYGEEDHALYVEFRPKLKATPFKFPQL
KNHEISFVIANTLVKSNKFETAPTNYNLRVIEVTVAANALATRYSVALPSHKDNSNSERG
NLRDFMDAYYARYENQAQPWNGDIGTGIERLLKMLQLVEESFSRKKSGFTVHEASTALNC
SREEFTRDYLTTFPVRFQVLKLYQRAKHVYSESLRVLKALKMMTSATFHTDEDFFTDFGR
LMNESQASCDKLYECSCIETNQICSIALANGSFGSRLTGAGWGGCTIHLVPSGANGNVEQ
VRKALIEKFYNVRYPDLTDEELKDAIIVSKPALGTCLYEQ
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaaacgttccaatattcagttctccggtcagagatttaccaaggtctttcgaa
caaaaacatttagcggttgtagatgcatttttccaaacataccatgtcaaacctgatttt
atcgctaggtctcctggcagagtaaatctgattggtgagcatatagattattgcgatttt
tcagttttgccattagccattgatgtggatatgctttgcgcagttaaaattttagacgaa
aaaaatccatccattaccttaacaaatgcggaccctaaatttgctcagcgaaagtttgat
ctgcctttagatggttcctacatggccatagatccgtctgtgtcggaatggtcgaattac
tttaaatgcggactacatgtggcacattcatacttgaaaaaaattgctccggaaagattt
aataatacacccttagtaggtgcgcagatcttttgccagagcgatattcctactggtggt
ggactctcatctgcatttacttgcgcggcagcactagccacaattagagccaatatggga
aaaaattttgatatttccaaaaaagacttgacccgcatcacagcggttgctgagcactat
gttggagtcaataatggtggtatggatcaagcaacgtctgtttatggggaagaagatcat
gctctatacgtagagtttaggccaaaactaaaggccacacctttcaagtttcctcaattg
aaaaatcatgaaatcagtttcgtcatcgccaatactcttgtaaagtctaataaattcgaa
actgctcctacaaattacaatttaagagtaatagaggtaacagttgctgccaacgccttg
gcgaccagatacagcgtggccttaccatctcacaaggacaattctaactcagaaagaggg
aatctaagagattttatggatgcttactacgccagatacgaaaaccaagcccaaccatgg
aatggagatatcggaactggtattgaacgtttactcaagatgctacaattggtagaagaa
tctttctcgaggaaaaagagcggattcactgtacatgaagcctctacggcgctaaactgt
tcacgtgaggagttcactagagattacctgacaacttttcccgtccgcttccaagtcttg
aaactatatcaaagagctaaacacgtttactccgaatccttaagggtgcttaaggcttta
aaaatgatgacaagtgccacttttcacacggacgaagatttctttacagattttggccga
ctaatgaatgagtcccaggcctcttgtgataaactttatgaatgttcgtgcatagaaacc
aatcaaatatgctcgattgccctagcaaatggttctttcggctcccgtctcactggcgct
ggttggggcggttgcactatccaccttgttcctagtggcgctaatgggaacgtggaacag
gtacgaaaagcactaatcgaaaaattctacaatgtaagatatccggatctcacagatgaa
gaactaaaagacgcaattatagtttcgaagcctgccttgggtacttgtttgtacgaacaa
taa

DBGET integrated database retrieval system