KEGG   Saccharomyces cerevisiae (budding yeast): YDR036CHelp
Entry
YDR036C           CDS       T00005                                 

Gene name
EHD3
Definition
Ehd3p (EC:3.1.2.4)
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sce01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sce00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:sce00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:sce00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:complement(523211..524713)
Genome map
AA seq 500 aa AA seqDB search
MLRNTLKCAQLSSKYGFKTTTRTFMTTQPQLNVTDAPPVLFTVQDTARVITLNRPKKLNA
LNAEMSESMFKTLNEYAKSDTTNLVILKSSNRPRSFCAGGDVATVAIFNFNKEFAKSIKF
FTDEYSLNFQIATYLKPIVTFMDGITMGGGVGLSIHTPFRIATENTKWAMPEMDIGFFPD
VGSTFALPRIVTLANSNSQMALYLCLTGEVVTGADAYMLGLASHYVSSENLDALQKRLGE
ISPPFNNDPQSAYFFGMVNESIDEFVSPLPKDYVFKYSNEKLNVIEACFNLSKNGTIEDI
MNNLRQYEGSAEGKAFAQEIKTKLLTKSPSSLQIALRLVQENSRDHIESAIKRDLYTAAN
MCMNQDSLVEFSEATKHKLIDKQRVPYPWTKKEQLFVSQLTSITSPKPSLPMSLLRNTSN
VTWTQYPYHSKYQLPTEQEIAAYIEKRTNDDTGAKVTEREVLNHFANVIPSRRGKLGIQS
LCKIVCERKCEEVNDGLRWK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgctcagaaatacgctaaaatgtgcccaattgtcgtctaaatacggatttaaaactacc
acacgtacattcatgactactcaaccccagctaaatgtcaccgacgcaccacctgtgcta
tttaccgttcaagatacagctagagttatcacgctaaataggcccaaaaagctcaatgct
ttgaacgccgaaatgtcagaatccatgttcaagactttgaacgagtatgcaaagagcgat
actacaaacttagtcattttaaagtcatccaaccgaccacgttcgttctgtgctggtggt
gatgtagctactgtggcaatattcaattttaacaaagaatttgccaagtccatcaaattt
tttactgatgaatattctttgaattttcaaatagcaacttacttgaaaccaattgttacc
ttcatggacggtatcaccatgggtggcggcgttggtctatccattcacacgccctttaga
attgctacagaaaacaccaaatgggccatgcccgagatggacattggtttttttccagat
gtaggctcaacttttgctctccctagaatcgtgacattggctaactcaaactcacaaatg
gccctgtatctatgtcttacaggagaagtagtcacaggagcagacgcttatatgctcggc
ttagcgtctcattacgtcagtagtgaaaatttagatgctttgcagaaaagattaggtgaa
attagccccccttttaataacgatccacaatctgcatacttcttcgggatggttaacgaa
tccatcgacgaattcgtatcaccattaccaaaagattatgttttcaagtattctaacgag
aaattaaacgttattgaagcctgttttaacttgtctaaaaatggtactattgaagacata
atgaataacttacgtcaatatgaaggttctgcggaaggtaaggctttcgcacaagaaatc
aaaacgaaattgttaaccaagtcaccatcctctcttcaaatcgccttgagattggtgcaa
gagaattccagagatcacatagaatctgctatcaaaagagacttatacacagcagctaac
atgtgcatgaaccaggactctttggtggaattctctgaagccacaaagcataaacttatt
gataaacaaagggtcccgtatccatggacaaagaaggaacagttatttgtatctcagttg
acatctatcacatctcctaaaccatcgctaccaatgtcattactaagaaatacctcgaat
gttacttggactcaatatccctaccattctaaataccaattgcctacagaacaggaaatc
gctgcgtatattgaaaagagaacgaatgatgacactggcgccaaagttaccgaaagagaa
gtactaaatcactttgccaatgtgattccttctagaagagggaaactgggtatccaatcg
ctatgtaaaattgtttgtgaaagaaaatgtgaagaagttaacgatggcttaagatggaaa
taa

DBGET integrated database retrieval system