KEGG   Saccharomyces cerevisiae (budding yeast): YDR036CHelp
Entry
YDR036C           CDS       T00005                                 

Gene name
EHD3
Definition
Ehd3p (EC:3.1.2.4)
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YDR036C (EHD3)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    YDR036C (EHD3)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YDR036C (EHD3)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YDR036C (EHD3)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     YDR036C (EHD3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:complement(523211..524713)
Genome map
AA seq 500 aa AA seqDB search
MLRNTLKCAQLSSKYGFKTTTRTFMTTQPQLNVTDAPPVLFTVQDTARVITLNRPKKLNA
LNAEMSESMFKTLNEYAKSDTTNLVILKSSNRPRSFCAGGDVATVAIFNFNKEFAKSIKF
FTDEYSLNFQIATYLKPIVTFMDGITMGGGVGLSIHTPFRIATENTKWAMPEMDIGFFPD
VGSTFALPRIVTLANSNSQMALYLCLTGEVVTGADAYMLGLASHYVSSENLDALQKRLGE
ISPPFNNDPQSAYFFGMVNESIDEFVSPLPKDYVFKYSNEKLNVIEACFNLSKNGTIEDI
MNNLRQYEGSAEGKAFAQEIKTKLLTKSPSSLQIALRLVQENSRDHIESAIKRDLYTAAN
MCMNQDSLVEFSEATKHKLIDKQRVPYPWTKKEQLFVSQLTSITSPKPSLPMSLLRNTSN
VTWTQYPYHSKYQLPTEQEIAAYIEKRTNDDTGAKVTEREVLNHFANVIPSRRGKLGIQS
LCKIVCERKCEEVNDGLRWK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgctcagaaatacgctaaaatgtgcccaattgtcgtctaaatacggatttaaaactacc
acacgtacattcatgactactcaaccccagctaaatgtcaccgacgcaccacctgtgcta
tttaccgttcaagatacagctagagttatcacgctaaataggcccaaaaagctcaatgct
ttgaacgccgaaatgtcagaatccatgttcaagactttgaacgagtatgcaaagagcgat
actacaaacttagtcattttaaagtcatccaaccgaccacgttcgttctgtgctggtggt
gatgtagctactgtggcaatattcaattttaacaaagaatttgccaagtccatcaaattt
tttactgatgaatattctttgaattttcaaatagcaacttacttgaaaccaattgttacc
ttcatggacggtatcaccatgggtggcggcgttggtctatccattcacacgccctttaga
attgctacagaaaacaccaaatgggccatgcccgagatggacattggtttttttccagat
gtaggctcaacttttgctctccctagaatcgtgacattggctaactcaaactcacaaatg
gccctgtatctatgtcttacaggagaagtagtcacaggagcagacgcttatatgctcggc
ttagcgtctcattacgtcagtagtgaaaatttagatgctttgcagaaaagattaggtgaa
attagccccccttttaataacgatccacaatctgcatacttcttcgggatggttaacgaa
tccatcgacgaattcgtatcaccattaccaaaagattatgttttcaagtattctaacgag
aaattaaacgttattgaagcctgttttaacttgtctaaaaatggtactattgaagacata
atgaataacttacgtcaatatgaaggttctgcggaaggtaaggctttcgcacaagaaatc
aaaacgaaattgttaaccaagtcaccatcctctcttcaaatcgccttgagattggtgcaa
gagaattccagagatcacatagaatctgctatcaaaagagacttatacacagcagctaac
atgtgcatgaaccaggactctttggtggaattctctgaagccacaaagcataaacttatt
gataaacaaagggtcccgtatccatggacaaagaaggaacagttatttgtatctcagttg
acatctatcacatctcctaaaccatcgctaccaatgtcattactaagaaatacctcgaat
gttacttggactcaatatccctaccattctaaataccaattgcctacagaacaggaaatc
gctgcgtatattgaaaagagaacgaatgatgacactggcgccaaagttaccgaaagagaa
gtactaaatcactttgccaatgtgattccttctagaagagggaaactgggtatccaatcg
ctatgtaaaattgtttgtgaaagaaaatgtgaagaagttaacgatggcttaagatggaaa
taa

DBGET integrated database retrieval system