KEGG   Saccharomyces cerevisiae (budding yeast): YDR036CHelp
Entry
YDR036C           CDS       T00005                                 

Gene name
EHD3
Definition
(RefSeq) Ehd3p
  KO
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    YDR036C (EHD3)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YDR036C (EHD3)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YDR036C (EHD3)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     YDR036C (EHD3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
SGD: 
UniProt: 
Position
IV:complement(523211..524713)
Genome map
AA seq 500 aa AA seqDB search
MLRNTLKCAQLSSKYGFKTTTRTFMTTQPQLNVTDAPPVLFTVQDTARVITLNRPKKLNA
LNAEMSESMFKTLNEYAKSDTTNLVILKSSNRPRSFCAGGDVATVAIFNFNKEFAKSIKF
FTDEYSLNFQIATYLKPIVTFMDGITMGGGVGLSIHTPFRIATENTKWAMPEMDIGFFPD
VGSTFALPRIVTLANSNSQMALYLCLTGEVVTGADAYMLGLASHYVSSENLDALQKRLGE
ISPPFNNDPQSAYFFGMVNESIDEFVSPLPKDYVFKYSNEKLNVIEACFNLSKNGTIEDI
MNNLRQYEGSAEGKAFAQEIKTKLLTKSPSSLQIALRLVQENSRDHIESAIKRDLYTAAN
MCMNQDSLVEFSEATKHKLIDKQRVPYPWTKKEQLFVSQLTSITSPKPSLPMSLLRNTSN
VTWTQYPYHSKYQLPTEQEIAAYIEKRTNDDTGAKVTEREVLNHFANVIPSRRGKLGIQS
LCKIVCERKCEEVNDGLRWK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgctcagaaatacgctaaaatgtgcccaattgtcgtctaaatacggatttaaaactacc
acacgtacattcatgactactcaaccccagctaaatgtcaccgacgcaccacctgtgcta
tttaccgttcaagatacagctagagttatcacgctaaataggcccaaaaagctcaatgct
ttgaacgccgaaatgtcagaatccatgttcaagactttgaacgagtatgcaaagagcgat
actacaaacttagtcattttaaagtcatccaaccgaccacgttcgttctgtgctggtggt
gatgtagctactgtggcaatattcaattttaacaaagaatttgccaagtccatcaaattt
tttactgatgaatattctttgaattttcaaatagcaacttacttgaaaccaattgttacc
ttcatggacggtatcaccatgggtggcggcgttggtctatccattcacacgccctttaga
attgctacagaaaacaccaaatgggccatgcccgagatggacattggtttttttccagat
gtaggctcaacttttgctctccctagaatcgtgacattggctaactcaaactcacaaatg
gccctgtatctatgtcttacaggagaagtagtcacaggagcagacgcttatatgctcggc
ttagcgtctcattacgtcagtagtgaaaatttagatgctttgcagaaaagattaggtgaa
attagccccccttttaataacgatccacaatctgcatacttcttcgggatggttaacgaa
tccatcgacgaattcgtatcaccattaccaaaagattatgttttcaagtattctaacgag
aaattaaacgttattgaagcctgttttaacttgtctaaaaatggtactattgaagacata
atgaataacttacgtcaatatgaaggttctgcggaaggtaaggctttcgcacaagaaatc
aaaacgaaattgttaaccaagtcaccatcctctcttcaaatcgccttgagattggtgcaa
gagaattccagagatcacatagaatctgctatcaaaagagacttatacacagcagctaac
atgtgcatgaaccaggactctttggtggaattctctgaagccacaaagcataaacttatt
gataaacaaagggtcccgtatccatggacaaagaaggaacagttatttgtatctcagttg
acatctatcacatctcctaaaccatcgctaccaatgtcattactaagaaatacctcgaat
gttacttggactcaatatccctaccattctaaataccaattgcctacagaacaggaaatc
gctgcgtatattgaaaagagaacgaatgatgacactggcgccaaagttaccgaaagagaa
gtactaaatcactttgccaatgtgattccttctagaagagggaaactgggtatccaatcg
ctatgtaaaattgtttgtgaaagaaaatgtgaagaagttaacgatggcttaagatggaaa
taa

DBGET integrated database retrieval system