KEGG   Saccharomyces cerevisiae (budding yeast): YDR052CHelp
Entry
YDR052C           CDS       T00005                                 

Gene name
DBF4, DNA52, LSD7
Definition
Dbf4p
Orthology
K02309  
regulatory subunit for Cdc7p protein kinase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YDR052C (DBF4)
   04113 Meiosis - yeast
    YDR052C (DBF4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
IV:complement(558511..560625)
Genome map
AA seq 704 aa AA seqDB search
MVSPTKMIIRSPLKETDTNLKHNNGIAASTTAAGHLNVFSNDNNCNNNNTTESFPKKRSL
ERLELQQQQHLHEKKRARIERARSIEGAVQVSKGTGLKNVEPRVTPKELLEWQTNWKKIM
KRDSRIYFDITDDVEMNTYNKSKMDKRRDLLKRGFLTLGAQITQFFDTTVTIVITRRSVE
NIYLLKDTDILSRAKKNYMKVWSYEKAARFLKNLDVDLDHLSKTKSASLAAPTLSNLLHN
EKLYGPTDRDPRTKRDDIHYFKYPHVYLYDLWQTWAPIITLEWKPQELTNLDELPYPILK
IGSFGRCPFIGDRNYDESSYKRVVKRYSRDKANKKYALQLRALFQYHADTLLNTSSVNDQ
TKNLIFIPHTCNDSTKSFKKWMQEKAKNFEKTELKKTDDSAVQDVRNEHADQTDEKNSIL
LNETETKEPPLKEEKENKQSIAEESNKYPQRKELAATPKLNHPVLATFARQETEEVPDDL
CTLKTKSRQAFEIKASGAHQSNDVATSFGNGLGPTRASVMSKNMKSLSRLMVDRKLGVKQ
TNGNNKNYTATIATTAETSKENRHRLDFNALKKDEAPSKETGKDSAVHLETNRKPQNFPK
VATKSVSADSKVHNDIKITTTESPTASKKSTSTNVTLHFNAQTAQTAQPVKKETVKNSGY
CENCRVKYESLEQHIVSEKHLSFAENDLNFEAIDSLIENLRFQI
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atggtttctccaacgaaaatgataataaggtctccgttaaaggaaacagataccaacttg
aaacataataatggaattgccgcatcaacaacagcagcgggccacttgaatgtgttttct
aacgacaataattgcaacaataacaataccactgaatcctttccgaagaaaagatctctt
gagcgcctcgagctccaacagcagcagcatttgcatgaaaagaaaagggccagaatagaa
agggccaggtctattgaaggcgctgtccaagtcagcaaaggtacgggtctgaaaaatgtc
gagccaagggttacgcctaaggaattgctggaatggcaaacaaattggaaaaagataatg
aaaagagattctcgcatttactttgacattactgatgatgtagagatgaatacatataat
aagtccaagatggacaaacgcagagatttattgaaaagagggtttcttacattgggtgcg
caaataactcaattttttgacactactgtcacaatagttatcacaagaaggtctgttgag
aacatatatttactaaaagataccgacattttatcgagagctaaaaaaaactacatgaaa
gtttggagttacgaaaaggctgccagatttctgaaaaatcttgatgttgatttggatcat
ttgagcaagactaaatctgcttctttagctgcgcccacattgtccaatcttctacacaat
gaaaaattatatggaccaacggatagagaccccagaactaaaagagacgatattcactac
tttaaatatcctcatgtatacctttatgacctatggcaaacttgggcccccataataact
ttggaatggaaacctcaagaactaacaaacttagacgaactaccttacccaatattgaaa
ataggttcattcggaagatgcccttttataggggataggaattatgacgaaagttcttat
aagcgcgtagtaaagagatactcgagagacaaagcaaacaaaaaatatgcactgcaactt
cgtgctctatttcaatatcatgccgacaccttactgaatacgtcatcagttaatgatcaa
acgaaaaacctaatattcatacctcacacatgcaacgattctaccaagagcttcaaaaaa
tggatgcaagaaaaggcaaaaaattttgagaagaccgagttaaagaagacggatgatagc
gcagttcaagatgttcgtaatgaacatgctgaccaaaccgatgaaaaaaatagtatatta
ttaaatgaaactgaaaccaaagagcctccgttgaaagaagaaaaagaaaataaacaatct
atagcagaagaatcgaataagtacccacagcgaaaagagctggctgccacaccaaaacta
aaccatccagtattagctacttttgcaaggcaagaaactgaagaagtgccggatgatttg
tgcactttgaaaacaaagtcacgtcaggcatttgaaatcaaagcaagtggtgcacatcaa
tctaatgatgtggcaacctcttttggcaatggtttgggcccaacaagagcaagcgtcatg
agtaagaacatgaagtcattaagtagactaatggttgatagaaagctgggagtaaagcag
acaaatggaaataacaaaaattatacagccactatagcaactactgctgaaacatcaaag
gaaaatagacacagattagattttaatgctttgaaaaaagacgaagccccttcgaaagag
acgggcaaagatagtgctgtacacttagaaactaatagaaagccccagaatttccctaag
gtagctaccaaatcagtctccgcagactccaaagttcataatgacatcaagataacaacc
acagaatctccaacagcatcgaagaaatcaacttccacaaacgtcaccttacattttaac
gcacagacagcacagacagcacagccggtgaagaaagaaacggtaaaaaattccggatac
tgtgaaaattgtcgtgtaaaatacgaatctttagaacaacacatagtttctgagaagcat
ttgtctttcgctgaaaacgatttaaattttgaggctattgactcgttaattgaaaatctc
agatttcaaatatag

DBGET integrated database retrieval system