KEGG   Saccharomyces cerevisiae (budding yeast): YDR069CHelp
Entry
YDR069C           CDS       T00005                                 

Gene name
DOA4, DOS1, MUT4, NPI2, SSV7, UBP4
Definition
Doa4p (EC:3.4.19.12 3.1.2.15)
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    YDR069C (DOA4)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     YDR069C (DOA4)
Peptidases [BR:sce01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   YDR069C (DOA4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:complement(584939..587719)
Genome map
AA seq 926 aa AA seqDB search
MEQNIISTIRDECIRHRSKYLTIAQLTAIAEAKINEFIITGKAKDQDLSSLLDKCIDILS
IYKKNSKDIKNIISCKNKGAMISSNSVMIIQLNYVYYKVIHIIVTTNIPHLSEFAKIKLH
KSTSDEGNGNNNNNEFQLMNIYNTLLETLLKDENIAKIKSFIKSSIKQTKLNHEQEECNL
MRTGSYITSNQLNSLISSSANSASSQMEILLIDIRSRLEFNKSHIDTKNIICLEPISFKM
SYSDHDLEKKSLITSPNSEIKMFQSRNLFKFIILYTDANEYNVKQQSVLLDILVNHSFEK
PISDDFTKIFILESGFPGWLKSNYGRQVSSSFPSNNNIKDDSVYINGNTSGLSLQHLPKM
SPSIRHSMDDSMKEMLVAPTPLNHLQQQQQQQSDNDHVLKRSSSFKKLFSNYTSPNPKNS
NSNLYSISSLSISSSPSPLPLHSPDPVKGNSLPINYPETPHLWKNSETDFMTNQREQLNH
NSFAHIAPINTKAITSPSRTATPKLQRFPQTISMNLNMNSNGHSSATSTIQPSCLSLSNN
DSLDHTDVTPTSSHNYDLDFAVGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHIN
INSKLGSKGILAKYFARLVHMMYKEQVDGSKKISISPIKFKLACGSVNSLFKTASQQDCQ
EFCQFLLDGLHEDLNQCGSNPPLKELSQEAEARREKLSLRIASSIEWERFLTTDFSVIVD
LFQGQYASRLKCKVCSHTSTTYQPFTVLSIPIPKKNSRNNITIEDCFREFTKCENLEVDE
QWLCPHCEKRQPSTKQLTITRLPRNLIVHLKRFDNLLNKNNDFVIYPFLLDLTPFWANDF
DGVFPPGVNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGLKKGWLYFDDTK
YKPVKNKADAINSNAYVLFYHRVYGV
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atggagcagaatattattagtaccataagggatgagtgtattcgtcaccggtcgaagtac
cttacgatagcacaactaaccgctattgcagaggctaaaattaacgaattcatcataact
ggtaaggcaaaagatcaagatttgagcagtcttctagataaatgcatcgatattttatct
atttacaagaagaactcgaaagatatcaaaaatattatatcgtgcaaaaataagggtgca
atgattagttcaaattccgtaatgattattcaattaaattatgtttactacaaggtaatt
cacattattgtaacaaccaatattcctcatttaagtgaattcgccaagattaaattacat
aagagcacgagtgatgagggcaacggtaataacaacaataatgaatttcaactcatgaac
atttacaacactttgctggaaaccttattaaaagatgaaaacattgcaaaaataaaaagt
ttcattaagtcttccataaaacaaacaaaattgaaccatgagcaagaagaatgtaacctg
atgagaacgggttcctatatcacttccaatcaattaaactccctaataagttcatcagca
aattctgcttcctcccaaatggagatactactgatagatatacgatcaaggttggaattc
aacaagtcacatattgatacaaaaaatattatatgcctggagcctatttcttttaaaatg
tcatattcagatcatgatttggagaaaaaatcattaattacttctcctaatagtgagatt
aaaatgtttcaaagtagaaatcttttcaagtttatcattctctatacagacgcaaacgaa
tacaatgttaaacagcagtctgtcctgttggacattctggtgaatcattcctttgaaaaa
ccaatatccgatgactttaccaaaattttcattctggaatctggttttccaggttggctt
aagtcaaattatgggaggcaagtatcatcatcttttccatcaaataacaatattaaagat
gatagtgtttatattaatggtaacacttctggcctaagtttacaacatttacctaagatg
tctcccagtataagacattcaatggacgactctatgaaagaaatgctagttgcgcctact
ccattaaatcatcttcaacaacagcaacaacagcaatcagacaatgatcatgtgctaaaa
agatcttcaagtttcaaaaaattattctcaaattatacgtctcctaatccgaagaattca
aattcaaacttatattctatatcttcgttgtccatatctagttcaccatcgcctttacct
ctacattcgcctgacccagttaagggcaattcattgccaatcaattatccggaaacgcca
catctttggaaaaacagtgagacagattttatgacaaatcaaagagaacagttgaatcac
aactcttttgctcacatagctcctatcaacacgaaggccatcacttctccatcaagaact
gccacaccgaagttacaacgcttcccgcaaacaattagtatgaaccttaatatgaactcc
aatggacacagttctgccacctctaccattcaaccttcgtgtctatccttgtctaataat
gactctttagatcatacagatgttacaccaacttcttctcataattatgaccttgatttc
gcggttggtttggaaaatctaggaaattcgtgttacatgaactgtatcattcagtgtatc
ttaggtacacacgaattaacccaaatctttttggacgattcatatgctaaacacatcaat
attaatagtaagttgggatcgaaaggtattctggcaaaatattttgcaaggttggttcat
atgatgtataaggaacaggttgatggttcaaagaaaatttccatatcaccgataaaattt
aaattggcatgtggatctgttaactcattatttaagactgcatcccaacaggactgccaa
gagttttgccaattccttctagatggtcttcatgaagacttgaaccaatgcggttcaaac
ccacctttgaaggagctttctcaagaagctgaggcgagaagagaaaaactgtctttgcga
attgcctcgtcaattgagtgggaacgattcttgactactgatttcagtgttattgtcgac
ttatttcagggacaatacgcctcacgactaaaatgtaaagtctgtagtcatacctcgaca
acataccaaccttttacggtgctgtcaatccctattcctaaaaaaaattcccgaaataat
attaccattgaagattgtttcagagagttcaccaaatgtgagaacttggaagtggatgag
caatggttgtgcccacattgtgaaaaaaggcagccctccacgaaacaattgacaataacg
agattaccgaggaatctgatagtccatttaaagagatttgataatttattaaacaaaaat
aatgacttcgtcatatacccttttttgttggacttgactccattttgggccaatgatttt
gacggggtttttcctccaggtgttaatgacgatgaactaccaataaggggacaaatacca
ccttttaagtatgaattatatggtgtagcatgccactttggtactttgtatggtggtcat
tatacagcctatgtgaaaaagggattaaagaagggatggctatattttgatgataccaaa
tataaacctgtcaaaaacaaagccgatgcaattaactctaatgcatacgttttgttttat
caccgcgtctacggtgtttga

DBGET integrated database retrieval system