KEGG   Saccharomyces cerevisiae (budding yeast): YDR098C-BHelp
Entry
YDR098C-B         CDS       T00005                                 

Definition
gag-pol fusion protein (EC:2.7.7.49 2.7.7.7 3.4.23.- 3.1.26.4)
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:complement(join(645858..649820,649822..651126))
Genome map
AA seq 1755 aa AA seqDB search
MESQQLSNYPHISHGSACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPAS
SAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANPSGWSFYGHPSMIPYTPYQMSPM
YFPPGPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPMLTSPND
FPNWVKTYIKFLQNSNLGGIIPTVNGKPVRQITDDELTFLYNTFQIFAPSQFLPTWVKDI
LSVDYTDIMKILSKSIEKMQSDTQEANDIVTLANLQYNGSTPADAFETKVTNIIDRLNNN
GIHINNKVACQLIMRGLSGEYKFLRYTRHRHLNMTVAELFLDIHAIYEEQQGSRNSKPNY
RRNPSDEKNDSRSYTNTTKPKVIARNPQKTNNSKSKTARAHNVSTSNNSPSTDNDSISKS
TTEPIQLNNKHDLHLGQELTESTVNHTNHSDDELPGHLLLDSGASRTLIRSAHHIHSASS
NPGINVVDAQKRNIPINAIGDLQFHFQDNTKTSIKVLHTPNIAYDLLSLNELAAVDITAC
FTKNVLERSDGTVLAPIVKYGDFYWVSKKYLLPSNISVPTINNVHTSESTRKYPYPFIHR
MLAHANAQTIRYSLKNNTITYFNESDVDWSSAIDYQCPDCLIGKSTKHRHIKGSRLKYQN
SYEPFQYLHTDIFGPVHNLPNSAPSYFISFTDETTKFRWVYPLHDRREDSILDVFTTILA
FIKNQFQASVLVIQMDRGSEYTNRTLHKFLEKNGITPCYTTTADSRAHGVAERLNRTLLD
DCRTQLQCSGLPNHLWFSAIEFSTIVRNSLASPKSKKSARQHAGLAGLDISTLLPFGQPV
IVNDHNPNSKIHPRGIPGYALHPSRNSYGYIIYLPSLKKTVDTTNYVILQGKESRLDQFN
YDALTFDEDLNRLTASYHSFIASNEIQESNDLNIESDHDFQSDIELHPEQPRNVLSKAVS
PTDSTPPSTHTEDSKRVSKTNIRAPREVDPNISESNILPSKKRSSTPQISNIESTGSGGM
HKLNVPLLAPMSQSNTHESSHASKSKDFRHSDSYSENETNHTNVPISSTGGTNNKTVPQI
SDQETEKRIIHRSPSIDASPPENNSSHNIVPIKTPTTVSEQNTEESIIADLPLPDLPPES
PTEFPDPFKELPPINSHQTNSSLGGIGDSNAYTTINSKKRSLEDNETEIKVSRDTWNTKN
MRSLEPPRSKKRIHLIAAVKAVKSIKPIRTTLRYDEAITYNKDIKEKEKYIEAYHKEVNQ
LLKMNTWDTDKYYDRKEIDPKRVINSMFIFNRKRDGTHKARFVARGDIQHPDTYDSGMQS
NTVHHYALMTSLSLALDNNYYITQLDISSAYLYADIKEELYIRPPPHLGMNDKLIRLKKS
LYGLKQSGANWYETIKSYLIKQCGMEEVRGWSCVFKNSQVTICLFVDDMILFSKDLNANK
KIITTLKKQYDTKIINLGEGDNEIQYDILGLEIKYQRSKYMKLGMEKSLTEKLPKLNVPL
NPKGKKLRAPGQPGHYIDQDELEIDEDEYKEKVHEMQKLIGLASYVGYKFRFDLLYYINT
LAQHILFPSRQVLDMTYELIQFMWDTRDKQLIWHKNKPTKPDNKLVAISDASYGNQPYYK
SQIGNIFLLNGKVIGGKSTKASLTCTSTTEAEIHAVSEAIPLLNNLSHLVQELNKKPIIK
GSLTDSRSTISIIKSTNEEKFRNRFFGTKAMRLRDEVSGNNLYVYYIETKKNIADVMTKP
LPIKTFKLLTNKWIH
NT seq 5268 nt NT seq  +upstreamnt  +downstreamnt
atggaatcccaacaattatctaattacccacatatatctcatggtagcgcctgtgcttcg
gttacttctaaggaagtccacacaaatcaagatccgttagacgtttcagcttccaaaatt
caagaatatgataaggcttccactaaggctaactctcaacagacaacaacacctgcttca
tcagctgttccagagaacccccatcatgcctctcctcaacctgcttcagtaccacctcca
cagaatgggccgtacccacagcagtgcatgatgacccaaaaccaagccaatccatctggt
tggtcattttacggacacccatctatgattccgtatacaccttatcaaatgtcgcctatg
tactttccacctgggccacaatcacagtttccgcagtatccatcatcagttggaacgcct
ctgagcactccatcacctgagtcaggtaatacatttactgattcatcctcagcggactct
gatatgacatccactaaaaaatatgtcagaccaccaccaatgttaacctcacctaatgac
tttccaaattgggttaaaacatacatcaaatttttacaaaactcgaatctcggtggtatt
attccgacagtaaacggaaaacccgtacgtcagatcactgatgatgaactcaccttcttg
tataacacttttcaaatatttgctccctctcaattcctacctacctgggtcaaagacatc
ctatccgttgattatacggatatcatgaaaattctttccaaaagtattgaaaaaatgcaa
tctgatacccaagaggcaaacgacattgtgaccctggcaaatttgcaatataatggcagt
acacctgcagatgcatttgaaacaaaagtcacaaacattatcgacagactgaacaataat
ggcattcatatcaataacaaggtcgcatgccaattaattatgagaggtctatctggcgaa
tataaatttttacgctacacacgtcatcgacatctaaatatgacagtcgctgaactgttc
ttagatatccatgctatttatgaagaacaacagggatcgagaaacagcaaacctaattac
aggagaaatccgagtgatgagaagaatgattctcgcagctatacgaatacaaccaaaccc
aaagttatagctcggaatcctcaaaaaacaaataattcgaaatcgaaaacagccagggct
cacaatgtatccacatctaataactctcccagcacggacaacgattccatcagtaaatca
actactgaaccgattcaattgaacaataagcacgaccttcatcttggccaggaacttact
gaatctacggtaaatcacactaatcattctgatgatgaactccctggacacctccttctc
gattcaggagcatcacgaacccttataagatctgctcaccacatacactcagcatcatct
aatcctggcataaacgtagttgatgctcaaaaaagaaatataccaattaacgctattggt
gacctacaatttcacttccaggacaacaccaaaacatcaataaaggtattgcacactcct
aacatagcctatgacttactcagtttgaatgaattggctgcagtagatatcacagcatgc
tttaccaaaaacgtcttagaacgatctgacggcactgtacttgcacctatcgtaaaatat
ggagacttttactgggtatctaaaaagtacttgcttccatcaaatatctccgtacccacc
atcaataatgtccatacaagtgaaagtacacgcaaatatccttatcctttcattcatcga
atgcttgcgcatgccaatgcacagacaattcgatactcacttaaaaataacaccatcacg
tattttaacgaatcagatgtcgactggtctagtgctattgactatcaatgtcctgattgt
ttaatcggcaaaagcaccaaacacagacatatcaaaggttcacgactaaaataccaaaat
tcatacgaaccctttcaatacctacatactgacatatttggtccagttcacaacctacca
aatagtgcaccatcctatttcatctcatttactgatgagacaacaaaattccgttgggtt
tatccattacacgaccgtcgcgaggactctatcctcgatgtttttactacgatactagct
tttattaaaaaccagtttcaggccagtgtcttggttatacaaatggaccgtggttctgag
tatactaacagaactctccataaattccttgaaaaaaatggtataactccatgctataca
accacagcggattcccgagcacatggagtcgctgaacggctaaaccgtaccttattagat
gactgccgtactcaactgcaatgtagtggtttaccgaaccatttatggttctctgcaatc
gaattttctactattgtgagaaattcactagcttcacctaaaagcaaaaaatctgcaaga
caacatgctggcttggcaggacttgatatcagtactttgttacctttcggtcaacctgtt
atcgtcaatgatcacaaccctaactccaaaatacatcctcgtggcatcccaggctacgct
ctacatccgtctcgaaactcttatggatatatcatctatcttccatccttaaagaagaca
gtagatacaactaactatgttattcttcagggcaaggaatccagattagatcaattcaat
tacgacgcactcactttcgatgaagacttaaaccgtttaactgcttcatatcattcgttc
attgcgtcaaatgagatccaagaatccaatgatcttaacatagaatctgaccatgacttc
caatccgacattgaactacatcctgagcaaccgagaaatgtcctttcaaaagctgtgagt
ccaaccgattccacacctccgtcaactcatactgaagattcgaaacgtgtttctaaaacc
aatattcgcgcacccagagaagttgaccccaacatatctgaatctaatattcttccatca
aagaagagatctagcaccccccaaatttccaatatcgagagtaccggttcgggtggtatg
cataaattaaatgttcctttacttgctcccatgtcccaatctaacacacatgagtcgtcg
cacgccagtaaatctaaagatttcagacactcagactcgtacagtgaaaatgagactaat
catacaaacgtaccaatatccagtacgggtggtaccaacaacaaaactgttccgcagata
agtgaccaagagactgagaaaaggattatacaccgttcaccttcaatcgatgcttctcca
ccggaaaataattcatcgcacaatattgttcctatcaaaacgccaactactgtttctgaa
cagaataccgaggaatctatcatcgctgatctcccactccctgatctacctccagaatct
cctaccgaattccctgacccatttaaagaactcccaccgataaattctcatcaaactaat
tccagtttgggtggtattggtgactctaatgcctatactactatcaacagtaagaaaaga
tcattagaagataatgaaactgaaattaaggtatcacgagacacatggaatactaagaat
atgcgtagtttagaacctccgagatcgaagaaacgaattcacctgattgcagctgtaaaa
gcagtaaaatcaatcaaaccaatacggacaaccttaagatacgatgaggcaatcacctat
aataaagatattaaagaaaaggaaaaatatatcgaagcataccacaaagaagtcaaccaa
ctattgaaaatgaatacttgggacactgacaaatattatgacagaaaagaaatagaccct
aaaagagtaataaattcaatgtttatcttcaacaggaaacgtgacggtactcataaagct
agatttgttgcaagaggtgatattcagcatcctgacacttacgactcaggcatgcaatcc
aataccgtacatcactatgcattaatgacatccctgtcacttgcattagacaataactac
tatattacacaattagacatatcttcggcatatttgtatgcagacatcaaagaagaatta
tacataagacctccaccacatttaggaatgaatgataagttgatacgtttgaagaaatca
ctttatggattgaaacaaagtggagcgaactggtacgaaactatcaaatcatacctgata
aaacagtgtggtatggaagaagttcgtggatggtcatgcgtatttaagaatagtcaagta
acaatttgcttattcgttgatgatatgatattgttcagcaaagacttaaatgcaaataag
aaaatcataacaacactcaagaaacaatacgatacaaagataataaatctgggtgaaggt
gataacgaaattcagtacgacatacttggattagagatcaaatatcaaagaagcaagtac
atgaaattaggtatggaaaaatccttgacagaaaaattacccaaactaaacgtacctttg
aacccaaaaggaaagaaacttagagctccaggtcaaccaggtcattatatagaccaggat
gaactagaaatagatgaagatgaatacaaagagaaagtgcatgaaatgcaaaagttgatt
ggtctagcttcatatgttggatataaatttagatttgacttactatactacatcaacaca
cttgctcaacatatactattcccctctaggcaagttttagacatgacatatgagttaata
caattcatgtgggacactagagataaacaattaatatggcacaaaaacaaacctaccaag
ccagataataaactagtcgcaataagcgatgcttcatatggtaaccaaccatattacaag
tcacaaattggtaacattttcctactcaacggaaaagtgattggaggaaagtcgacaaag
gcttcgttaacatgcacttcaactacagaagcagaaatacacgcagtcagtgaagctatt
ccgctattgaataacctcagtcaccttgtgcaagaacttaacaagaaaccaattattaaa
ggctcacttactgatagtagatcaacgatcagtataattaagtctacaaatgaagagaaa
tttagaaacagattttttggcacaaaggcaatgagacttagagatgaagtatcaggtaat
aatttatacgtatactacatcgagaccaagaagaacattgctgatgtgatgacaaaacct
cttccgataaaaacatttaaactattaacaaacaaatggattcattag

DBGET integrated database retrieval system