KEGG   Saccharomyces cerevisiae (budding yeast): YDR110WHelp
Entry
YDR110W           CDS       T00005                                 

Gene name
FOB1, HRM1
Definition
Fob1p
Orthology
K12577  
DNA replication fork-blocking protein FOB1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YDR110W (FOB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:676102..677802
Genome map
AA seq 566 aa AA seqDB search
MTKPRYNDVLFDDDDSVPSESVTRKSQRRKATSPGESRESSKDRLLILPSMGESYTEYVD
SYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKL
LFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHFAN
ISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEGKY
SYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYDICE
EIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGKCLRYGPYRFNRRRNK
RTKRKPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFALANE
ADNSCNNNGILHNNNIGNDNFEEEVQKQFDLTEKNYIDEYDDLAHDSSEGEFEPNTLTPE
EKPPHNVDEDRIESTGVAAPMQGTEEPEKGDQKESDGASQVDQSVEITRPETSYYQTLES
PSTKRQKLDQQGNGDQTRDFGTSMEL
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaccgcgttacaatgacgtgttgtttgatgatgatgactcggtaccatcagaa
tcagttacgaggaaatcgcagagaagaaaggcaacgtcacctggggaatcaagagagtcc
tcaaaagatcgtctactgatacttccctctatgggggaatcatatactgagtacgtagac
tcttatttgaacttagaattattggaaaggggagaaagagaaacaccaatctttcttgaa
tctctgacaagacaactaacgcagaaaatatatgaactaataaaaacaaaatctttaact
gcagataccttgcaacaaataagtgataaatacgatggtgtagtggcagaaaacaagctg
ttatttttgcaaagacagtattatgttgatgatgaaggaaatgttagagatggccgaaat
aatgataaaatatactgtgagccaaagcatgtatacgacatggtgatggcaacacacttg
atgaataagcatcttaggggtaaaacattacattcctttttattttctcattttgccaat
attagtcatgccatcatcgattgggtccagcaattttgttcaaaatgtaataaaaagggc
aaaattaaaccattgaaggaatataaacgtcctgacatgtacgataaactactaccaatg
gaaaggatacatattgaggtattcgaacccttcaatggagaagctattgagggaaaatat
tcttatgtccttttatgccgagactatcgctctagttttatgtggttattaccacttaag
agtaccaaattcaaacatcttatcccagttgtttcctcactttttttaacatttgctagg
gttccaattttcgtaacatcaagcactttagataaagatgatctttatgatatttgtgaa
gaaattgcatcaaaatacggtctccgtattggcttgggtttgaagagttctgcgagattt
catactgggggtatactgtgcattcagtatgctctaaatagttataagaaggaatgtcta
gccgattggggtaagtgcctaagatatggcccttacagattcaaccgaaggagaaataag
agaacgaaacgtaaacctgtgcaagtactacttagtgaagttccaggtcacaatgccaag
tttgagactaagagagaaagggttatagaaaacacatattcccgtaatatgttcaagatg
gcaggtggaaaaggtcttatatatttggaagatgtcaatacttttgcccttgctaatgaa
gcggataatagctgtaacaataatggaattcttcataataacaatataggaaatgataac
tttgaagaagaagtgcaaaaacaatttgatctaactgaaaaaaactatatcgatgagtat
gatgatttggcacatgattcttcagagggcgaatttgaacctaataccttaactcccgaa
gaaaagcctcctcataatgtcgatgaggaccgaatagagtccaccggcgtggcagcccca
atgcagggaacagaagagcctgaaaaaggggatcaaaaagaaagtgacggtgcatcacaa
gtagatcaaagtgtcgaaataactagaccagaaacttcctactatcaaactctggaatcg
ccgtcaacaaaacgacagaaattagaccaacagggtaatggagatcaaacaagagacttt
ggcacatcaatggaattgtaa

DBGET integrated database retrieval system