KEGG   Saccharomyces cerevisiae (budding yeast): YDR146CHelp
Entry
YDR146C           CDS       T00005                                 

Gene name
SWI5
Definition
Swi5p
Orthology
K09202  
regulatory protein SWI5
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YDR146C (SWI5)
Transcription factors [BR:sce03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    YDR146C (SWI5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
IV:complement(748613..750742)
Genome map
AA seq 709 aa AA seqDB search
MDTSNSWFDASKVQSLNFDLQTNSYYSNARGSDPSSYAIEGEYKTLATDDLGNILNLNYG
ETNEVIMNEINDLNLPLGPLSDEKSVKVSTFSELIGNDWQSMNFDLENNSREVTLNATSL
LNENRLNQDSGMTVYQKTMSDKPHDEKKISMADNLLSTINKSEINKGFDRNLGELLLQQQ
QELREQLRAQQEANKKLELELKQTQYKQQQLQATLENSDGPQFLSPKRKISPASENVEDV
YANSLSPMISPPMSNTSFTGSPSRRNNRQKYCLQRKNSSGTVGPLCFQELNEGFNDSLIS
PKKIRSNPNENLSSKTKFITPFTPKSRVSSATSNSANITPNNLRLDFKINVEDQESEYSE
KPLGLGIELLGKPGPSPTKSVSLKSASVDIMPTIPGSVNNTPSVNKVSLSSSYIDQYTPR
GKQLHFSSISENALGINAATPHLKPPSQQARHREGVFNDLDPNVLTKNTDNEGDDNEENE
PESRFVISETPSPVLKSQSKYEGRSPQFGTHIKEINTYTTNSPSKITRKLTTLPRGSIDK
YVKEMPDKTFECLFPGCTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAFVRNHDLIRH
KKSHQEKAYACPCGKKFNREDALVVHRSRMICSGGKKYENVVIKRSPRKRGRPRKDGTSS
VSSSPIKENINKDHNGQLMFKLEDQLRRERSYDGNGTGIMVSPMKTNQR
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggatacatcaaactcttggtttgatgcctcaaaagtacaaagcctaaattttgaccta
caaaccaactcttattactcaaatgctagaggcagtgacccttcgagttatgcaatagaa
ggcgaatataaaacactagcaacagatgatttaggcaatatattgaacctaaactatggt
gaaaccaacgaagttataatgaatgaaataaatgacttaaaccttccgctgggaccactt
tctgatgaaaaatctgtcaaggtttctactttctccgagttaataggaaatgattggcaa
agtatgaactttgacttagaaaataattcaagagaagtgactctaaatgcaactagcttg
ttgaatgaaaatagattaaatcaagacagtggtatgactgtttatcaaaaaacaatgagt
gataagccccacgatgaaaagaagatttccatggcggataatttattgtcgactataaac
aaaagtgaaattaataaaggcttcgatagaaacctcggggaattactgttacagcaacaa
caagagttgcgcgagcaattgagagcacaacaagaggctaataagaagttagagttagaa
ctcaaacaaacacaatacaagcaacaacaactacaggctaccttagagaactctgatggt
ccacagtttttatctcccaaaaggaagatctctcctgcttcagaaaatgtggaggatgta
tacgcaaatagcctttcaccaatgatttccccaccaatgtctaatacttcgttcactggg
tcaccttctaggagaaacaatagacaaaagtactgcctgcagagaaaaaactctagtggt
actgtaggaccactatgtttccaggaattgaacgaaggtttcaatgactccctcatttca
ccaaagaaaattcgctcgaatccaaatgaaaacctcagttcaaaaaccaaatttattacg
cccttcactccaaagagtagagttagttcagctacgtccaactctgctaacattacccct
aataacttaaggttagatttcaagattaatgttgaagatcaggaaagcgaatattcagag
aaacctttgggcctgggtattgaacttcttggaaaaccaggtccttctcctacaaaatca
gtgtctttaaagagtgcttctgtggatattatgcctacaattcctgggtctgtaaataat
actccatcagtcaataaagtatccctttcctccagttatatagaccaatatacaccaaga
ggtaagcagttacactttagctctatcagtgagaatgcattgggtatcaatgctgcgaca
ccacatctaaagccgccgagccagcaagcacgacatcgggaaggcgttttcaatgattta
gaccctaatgtacttacgaaaaatacagacaatgaaggagatgataatgaggaaaatgag
cctgaaagtagatttgttatttccgaaacgccttctcccgttcttaagtcacaaagtaag
tacgaaggaagatctcctcaattcggcacacacattaaggaaatcaacacatataccaca
aatagtccctcaaaaatcacaagaaaactcacaacactgcccagaggttcaatcgataaa
tatgtgaaggaaatgcctgataaaacatttgaatgtttatttcctggatgtacaaaaaca
ttcaagagaaggtataacatcagatctcatattcaaacacatttggaagatcggccatat
tcctgtgatcaccctggatgtgataaggcatttgtacgaaatcatgacttgataagacac
aaaaaatcgcaccaagaaaaggcgtatgcatgtccctgtggtaagaaattcaatagagaa
gacgctttggttgtgcacagaagtagaatgatttgcagcggtggtaaaaagtatgaaaac
gtggtaattaaaaggtctccaagaaaaagaggaagaccaagaaaagatggaacttcaagt
gtttctagtagtccaatcaaagaaaatattaacaaggatcataatggacagttgatgttc
aagcttgaagatcaactcagaagagagcgtagttatgatgggaatggaacggggattatg
gtttcgccaatgaaaactaatcaaaggtaa

DBGET integrated database retrieval system