KEGG   Saccharomyces cerevisiae (budding yeast): YDR148CHelp
Entry
YDR148C           CDS       T00005                                 

Gene name
KGD2
Definition
alpha-ketoglutarate dehydrogenase KGD2 (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YDR148C (KGD2)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YDR148C (KGD2)
  Amino acid metabolism
   00310 Lysine degradation
    YDR148C (KGD2)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     YDR148C (KGD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:complement(753675..755066)
Genome map
AA seq 463 aa AA seqDB search
MLSRATRTAAAKSLVKSKVARNVMAASFVKRHASTSLFKQANKVESLGSIYLSGKKISVA
ANPFSITSNRFKSTSIEVPPMAESLTEGSLKEYTKNVGDFIKEDELLATIETDKIDIEVN
SPVSGTVTKLNFKPEDTVTVGEELAQVEPGEAPAEGSGESKPEPTEQAEPSQGVAARENS
SEETASKKEAAPKKEAAPKKEVTEPKKADQPKKTVSKAQEPPVASNSFTPFPRTETRVKM
NRMRLRIAERLKESQNTAASLTTFNEVDMSALMEMRKLYKDEIIKKTGTKFGFMGLFSKA
CTLAAKDIPAVNGAIEGDQIVYRDYTDISVAVATPKGLVTPVVRNAESLSVLDIENEIVR
LSHKARDGKLTLEDMTGGTFTISNGGVFGSLYGTPIINSPQTAVLGLHGVKERPVTVNGQ
IVSRPMMYLALTYDHRLLDGREAVTFLKTVKELIEDPRKMLLW
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgctttccagagcgacgcgtactgcagctgccaaatccttagtaaaatctaaagtggct
agaaatgttatggctgcttctttcgtcaagagacatgcttctacaagtttgttcaaacaa
gctaacaaggtcgaatccttaggttcaatatatttatccggcaagaaaatttcagttgcg
gcgaatccgttctccataactagcaatcgttttaaatctacctctattgaagttcctccg
atggcagagtccctgactgaaggctctttaaaggaatatactaaaaacgttggtgatttt
attaaggaggacgagctgttggccactattgagaccgataaaattgatattgaggtcaat
tcgccagtatcaggtactgttacgaagctaaatttcaaaccagaggacactgtcactgtt
ggtgaggagttagctcaggtcgagcctggtgaagcacctgctgagggttctggagaatct
aagccagagcctaccgaacaagcggagccatcgcaaggtgtcgccgcaagggaaaactca
agtgaggaaacggcttcaaagaaagaagctgctccaaagaaagaagccgctccaaagaaa
gaagttacagaaccaaaaaaggctgatcaaccaaagaagaccgtctctaaggcgcaggaa
cccccagtagcctctaactctttcacaccatttccacgtacagaaaccagggtcaaaatg
aaccgtatgagattgaggattgccgaaagattaaaagagtctcaaaacactgctgcttcc
ttaaccacattcaacgaagttgacatgtcagctttgatggaaatgaggaaactgtataaa
gatgagattattaagaagaccggtactaaattcggattcatgggtcttttctccaaagca
tgtaccttggccgccaaggatattccagccgtcaatggtgccattgaaggtgaccagatt
gtttatcgtgattacacagatatttctgttgctgtggccactccaaagggtttggttacc
cccgtcgttcgtaatgcagagtcattgagtgttttagatattgagaacgaaattgttcgc
ttgagtcataaagcgcgtgatggcaaattaaccctagaagatatgacgggtggtactttc
accatatctaatggtggtgtttttggttcattatacggtactcctatcatcaattcacca
caaacagccgtcctaggcttgcatggtgtcaaagagagacctgtcactgttaatggacaa
attgtctcaagaccaatgatgtacttggctttgacttatgatcatagattgctagatggt
agagaagctgttaccttcttgaagactgttaaagagttgattgaagaccctagaaaaatg
ttgttatggtga

DBGET integrated database retrieval system