KEGG   Saccharomyces cerevisiae (budding yeast): YDR170W-AHelp
Entry
YDR170W-A         CDS       T00005                                 

Definition
(RefSeq) gag protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TYA Retrotran_gag_2 OKR_DC_1_C
Motif
Other DBs
NCBI-GeneID: 851750
NCBI-ProteinID: NP_010455
SGD: S000007227
UniProt: Q03964
Position
IV:803195..804517
Genome map
AA seq 440 aa AA seqDB search
MESQQLSQHSPISHGSACASVTSKEVQTTQDPLDISASKTEECEKVFTQANSQQPTTPPS
AAVPENHHHASPQAAQVPLPQNGPYPQQRMMTPQQANISGWPVYGHPSLMPYPPYQMSPM
YAPPGAQSQFTQYPQYVGTHLNTPSPESGNSFPDSSSAKSNMTSTNQHVRPPPILTSPND
FLNWVKIYIKFLQNSNLGDIIPTATRKAVRQMTDDELTFLCHTFQLFALSQFLPTWVKDI
LSVDYTDIMKILSKSINKMQSDTQEVNDITTLANLHYNGSTPADAFEAEVTNILDRLKNN
GIPINNKVACQFIMRGLSGEYKFLRYARHRYIHMTVADLFSDIHSMYEEQQESKRNKSTY
RRSPSDEKKDSRTYTNTTKPKSITRNSQKPNNSQSRTARAHNVSTSNNFPGPDNDLIRGS
TTEPIQLKNKHDLHLRPGTY
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggaatcccaacaattatctcaacattcacccatttctcatggtagcgcctgtgcttcg
gttacttctaaagaagtccaaacaactcaagatccgttagacatttcagcttccaaaaca
gaagaatgtgagaaggttttcactcaggctaattctcaacagccaacaacacctccctca
gctgctgttccagagaaccatcatcatgcctctcctcaagctgctcaagtaccattgcca
caaaatgggccgtacccacagcagcgaatgatgactccccaacaagccaatatttctggt
tggccagtatacgggcacccatctttgatgccgtatccaccttatcaaatgtcacctatg
tacgctccacctggagcacaatcacagtttacacaatatccacaatatgttggaacacat
ttgaacaccccgtcacctgagtcaggtaattcatttcctgattcatcctcagcaaagtct
aatatgacatccactaatcaacatgtcagaccaccgccaatcttaacctcacctaatgac
tttctaaattgggttaaaatatacatcaaatttttacaaaattcgaatctcggtgatatt
attccgacagcaacaagaaaagccgtacgtcagatgactgatgacgaactcaccttctta
tgtcacacctttcaactatttgctctatctcaattcttacccacctgggttaaagacatc
ttatctgttgattatacagatatcatgaaaattctttccaaaagcattaacaaaatgcag
tctgatactcaagaggtaaatgacattacgaccctagcaaatttgcattataatggaagt
acacctgcagatgcatttgaagcagaagtcacaaacattcttgacagactaaaaaacaat
ggcattcctatcaataacaaggtagcatgccaattcattatgagaggtctatctggcgaa
tacaaatttttacgctacgcacgtcatcgatatatacatatgacagttgctgatctgttt
tcagacatacattctatgtatgaagaacaacaggaatcaaaacgtaataaatctacttat
aggagaagtccgagtgatgagaagaaagactctcgcacctatacgaatacaaccaaaccc
aaatccataactcggaattcccaaaaaccaaataattcacaatcaagaacagccagggct
cataacgtatccacatctaataactttcccggccctgataacgatctcataagaggatca
actactgaaccgattcaattgaagaataaacacgaccttcaccttaggccaggaacttac
tga

DBGET integrated database retrieval system