KEGG   Saccharomyces cerevisiae (budding yeast): YDR180WHelp
Entry
YDR180W           CDS       T00005                                 

Gene name
SCC2
Definition
Scc2p
Orthology
K06672  
cohesin loading factor subunit SCC2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:821295..825776
Genome map
AA seq 1493 aa AA seqDB search
MSYPGKDKNIPGRIIEALEDLPLSYLVPKDGLAALVNAPMRVSLPFDKTIFTSADDGRDV
NINVLGTANSTTSSIKNEAEKERLVFKRPSNFTSSANSVDYVPTNFLEGLSPLAQSVLST
HKGLNDSINIEKKSEIVSRPEAKHKLESVTSNAGNLSFNDNSSNKKTKTSTGVTMTQANL
AEQYLNDLKNILDIVGFDQNSAEIGNIEYWLQLPNKKFVLTTNCLTKLQMTIKNITDNPQ
LSNSIEITWLLRLLDVMVCNIKFSKSSLKMGLDDSMLRYIALLSTIVLFNIFLLGKNDSN
LHRESYIMEPVNFLSDLIESLKILTIEYGSLKIEFDTFQEALELLPKYIRNGPFLDDNVT
AKLVYIFSDLLMNNDIEATTNIQFQSFWDNVKRISSDILVSLFGSFDQQRGFIIEELLSH
IEKLPTKRIQKKLRKVGNQNIYITDFTFTLMSMLENINCYSFCNQMKDIAPENIDLLKNE
YKKQEEFLFNIVEHINDTILERFFKNPSALRYVIDNFVQDLLLLISSPQWPVTEKILSSL
LKRLLSVYSPSMQVSANIETICLQLIGNIGSTIFDIKCSTRDHEDNNLIKMINYPETLPH
FFKSFEECIAYNETIKCRRSATRFLWNLRLGTILILEEYTKDAKEQIITVDNELKKILEQ
IKDGGLGPELENREADFSTIKLDYFSILHAFELLNLYDPYLKLILSLLAKDKIKLRSTAI
KCLSMLASKDKVILSNPMVKETIHRRLNDSSASVKDAILDLVSINSSYFEFYQQINNNYN
DDSIMVRKHVLRINEKMYDETNDIVTKVYVIARILMKIEDEEDNIIDMARLILLNRWILK
VHEVLDQPEKLKEISSSVLLVMSRVAIMNEKCSQLFDLFLNFYLLNKEAHSKEAYDKITH
VLTILTDFLVQKIVELNSDDTNEKNSIVDKQNFLNLLAKFADSTVSFLTKDHITALYPYM
VSDEKSDFHYYILQVFRCTFEKLANFKQKFLYDLETTLLSRLPKMNVREIDEAMPLIWSV
ATHRHDTARVAKACSSCLSHLHPYINKANNEEAAIVVDGKLQRLIYLSTGFARFCFPKPS
NDKIAFLQEGETLYEHITKCLLVLSKDKITHVIRRVAVKNLTKLCGNHPKLFNSRHVLHL
LDKEFQSDQLDIKLVILESLYDLFLLEERKSVRNTGVNSTLSSNSILKKKLLKTNRVEFA
NDGVCSALATRFLDNILQLCLLRDLKNSLVAIRLLKLILKFGYTNPSHSIPTVIALFAST
SQYIRHVAYELLEDLFEKYETLVFSSLSRGVTKAIHYSIHTDEKYYYKHDHFLSLLEKLC
GTGKKNGPKFFKVLKRIMQSYLDDITDLTSTNSSVQKSIFVLCTNISNITFVSQYDLVSL
LKTIDLTTDRLKEVIMDEIGDNVSSLSVSEEKLSGIILIQLSLQDLGTYLLHLYGLRDDV
LLLDIVEESELKNKQLPAKKPDISKFSAQLENIEQYSSNGKLLTYFRKHVKDT
NT seq 4482 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtacccagggaaagacaagaatattcctggaagaataatagaggccctagaagac
ctgcctttgagttatctggttcctaaggatgggttagccgcgctagtaaatgccccaatg
cgggtttctttaccttttgacaagactatctttaccagcgctgatgatggcagagatgtt
aatataaatgttctaggtacagctaacagcactacttcttccataaagaatgaggccgaa
aaagaaaggcttgttttcaaaagacccagtaattttacgtcatcagccaattctgttgat
tatgtcccaactaactttttggaaggattatcaccgctagcgcagagtgttctatcaacc
cataaagggttgaatgattccattaacatcgagaaaaaaagtgaaatagtaagcagaccg
gaggcaaagcataagctcgaaagtgtgacttcgaatgctggtaacttgagtttcaacgac
aattcttccaacaagaaaaccaaaacttcaacaggtgtaaccatgacacaagcgaattta
gcggaacaatatttgaatgatcttaaaaatattttagatattgttggatttgaccaaaac
tctgctgaaattggaaatatcgagtactggctccagttgccaaataaaaaattcgtttta
actacaaactgcttaaccaaattacaaatgacaattaaaaatattaccgataacccacag
ctatcgaactcaatcgaaataacatggcttttgagattgcttgatgtgatggtttgtaat
ataaagttcagtaaaagctctttaaagatgggtttagatgattctatgttacgatatatt
gctttgctttctacaattgtactattcaatatttttttactgggtaagaatgacagcaac
ttacatcgggaatcatacatcatggaaccggtgaattttttaagcgacttgatagaatct
ctaaaaatattaacaattgaatatggttctttgaagatagaatttgacactttccaggag
gccctagaattgctaccgaaatacatacgtaacggcccttttctggatgataatgtcacg
gcaaagcttgtgtacatctttagcgacttgctgatgaataatgacattgaagcaactacg
aatatccaatttcaaagtttttgggataatgtgaagagaatcagctctgatattttagtt
tcattattcggtagttttgatcaacagagaggatttattatagaagaactactatctcat
atcgaaaagcttcccactaagagaatacaaaaaaaactaagaaaagttggtaaccaaaac
atttatatcactgattttacctttactttaatgtcaatgttagagaatattaattgctac
tccttctgtaatcagatgaaggatattgcaccagagaatattgatctattaaagaacgaa
tacaaaaagcaagaagaatttctttttaacattgttgagcatataaatgacacaatactg
gaaaggtttttcaagaacccgtccgctttaaggtatgtaattgacaactttgtccaagat
ctattattgctaatttcctcccctcagtggcctgtaacagaaaaaatactaagctctttg
ttaaagagacttctaagtgtatacagcccatccatgcaagtttctgcaaacattgaaaca
atatgtttacaacttatagggaatattggttctacaatttttgatattaaatgctcaact
agagaccatgaagataacaacttgattaaaatgattaattaccccgaaactttgccgcat
ttttttaaatcatttgaagaatgcattgcatataatgaaacgatcaaatgccgtcgttct
gcaacaagattcctttggaatttaaggctcggtacgatcttgatattagaagagtataca
aaggatgccaaagaacaaattataaccgttgacaatgaattgaaaaaaatattggagcag
ataaaagatggtggacttggacccgaattagagaacagagaagcagattttagtacgatt
aaattggattatttttctattttgcacgcctttgaactactgaatctatacgatccatac
ttgaagttgatattatcacttctagccaaggataaaatcaaactgagatcgactgctatt
aaatgtctctcgatgttggcttcaaaagacaaagtgatactttcaaacccaatggttaaa
gaaactattcaccggcgtttaaacgactcatctgcatctgtcaaggatgccattctagat
ttggtcagtattaattcttcatacttcgaattttatcaacaaattaacaacaactataac
gatgatagcataatggtaagaaaacatgtgttaagaattaatgaaaaaatgtacgacgag
acgaacgacatcgtcacgaaggtatacgtaatagcaagaatcctaatgaaaatagaagac
gaggaggacaatataattgatatggctaggctgattttattaaatagatggatattaaag
gtacatgaagtattggaccagcccgaaaagttgaaagaaatttcttcttcagtcctacta
gtaatgtcccgtgtggctataatgaatgagaaatgctcccaacttttcgacttgtttctc
aacttttatctcctaaacaaagaagcgcattcaaaagaagcatacgataaaatcactcac
gttctaaccattcttaccgactttttggtacaaaaaattgtcgagctcaactcagatgac
acaaatgaaaagaattcgattgttgataaacaaaattttttaaaccttttggcgaagttt
gctgattctactgtgtcatttttgactaaagaccacattacagcattgtatccttatatg
gtatcggacgaaaaatctgacttccactattatatcttgcaagtctttagatgcactttt
gaaaaattggccaactttaaacagaaatttttgtatgacttagagacgacccttttgagt
aggctaccaaagatgaatgtaagagagatagatgaagctatgcctcttatctggtctgtt
gccactcatcgtcatgatactgctagagtagctaaagcatgttcatcctgtctttcccat
ttacatccatatataaataaggcaaataacgaggaagctgccattgtagttgacggaaaa
ttgcaaaggctgatatatttatccaccggttttgccaggttctgctttcctaaaccctcc
aatgataaaattgcatttttacaagaaggtgaaaccctgtatgaacatattaccaaatgc
ctacttgtactatctaaagacaaaattacacacgtaataagaagggttgctgtgaaaaat
ctcactaaattatgtggaaatcatccaaaactattcaattcaagacacgttctacattta
ctggacaaagaatttcagagcgatcagctagatattaaactagtaattctagaaagttta
tatgatctttttctactggaagaaaggaagtcagtgagaaacactggcgttaatagcact
ttgtcttcgaactccattttgaaaaagaaattactgaaaacgaatagggtagagtttgca
aatgatggagtatgttcagcgttggctactagatttttagacaatattctccaactatgt
ctcctacgtgatctaaagaattctctcgtagctattcgattattaaagttgattttgaaa
tttggttacacaaatccctctcattcaattccaactgtaattgctttatttgcctctact
agccagtatattcgtcatgtcgcctatgagttgttagaagatctttttgagaaatacgaa
acgctagtattcagtagtttatctcgaggggttacaaaagctatacattattctattcat
acagatgagaagtattattacaagcacgatcattttttgtctttacttgaaaaattatgt
ggaactggaaaaaaaaatggcccaaagttctttaaagttctgaagagaatcatgcaatcc
tatttagatgatatcaccgatttaacatcaacaaatagtagtgttcaaaagtccattttc
gttctctgcactaacatttcgaatatcacatttgtttctcagtacgatttggtgtcccta
ctcaaaaccattgatttaactacagatagattaaaagaggttatcatggatgaaataggt
gacaatgtttcatcgctatccgtatcagaagaaaagctcagtggaataattttaatacag
ttaagcttacaggatttgggtacttatctactgcacttatacgggttaagggatgatgtg
cttttattagatattgtagaagaatcagaattgaagaacaaacaactccctgcaaagaag
ccggatatcagtaagttttccgcacagttggagaatattgaacagtattcatcaaatggc
aagcttcttacatattttagaaaacacgtgaaggatacgtaa

DBGET integrated database retrieval system