KEGG   Saccharomyces cerevisiae (budding yeast): YDR211WHelp
Entry
YDR211W           CDS       T00005                                 

Gene name
GCD6
Definition
Gcd6p
Orthology
K03240  
translation initiation factor eIF-2B subunit epsilon
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    YDR211W (GCD6)
Translation factors [BR:sce03012]
 Eukaryotic Type
  Initiation factors
   eIF-2B
    YDR211W (GCD6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
IV:884727..886865
Genome map
AA seq 712 aa AA seqDB search
MAGKKGQKKSGLGNHGKNSDMDVEDRLQAVVLTDSYETRFMPLTAVKPRCLLPLANVPLI
EYTLEFLAKAGVHEVFLICSSHANQINDYIENSKWNLPWSPFKITTIMSPEARCTGDVMR
DLDNRGIITGDFILVSGDVLTNIDFSKMLEFHKKMHLQDKDHISTMCLSKASTYPKTRTI
EPAAFVLDKSTSRCIYYQDLPLPSSREKTSIQIDPELLDNVDEFVIRNDLIDCRIDICTS
HVPLIFQENFDYQSLRTDFVKGVISSDILGKHIYAYLTDEYAVRVESWQTYDTISQDFLG
RWCYPLVLDSNIQDDQTYSYESRHIYKEKDVVLAQSCKIGKCTAIGSGTKIGEGTKIENS
VIGRNCQIGENIRIKNSFIWDDCIIGNNSIIDHSLIASNATLGSNVRLNDGCIIGFNVKI
DDNMDLDRNTKISASPLKNAGSRMYDNESNEQFDQDLDDQTLAVSIVGDKGVGYIYESEV
SDDEDSSTEACKEINTLSNQLDELYLSDDSISSATKKTKKRRTMSVNSIYTDREEIDSEF
EDEDFEKEGIATVERAMENNHDLDTALLELNTLRMSMNVTYHEVRIATITALLRRVYHFI
ATQTLGPKDAVVKVFNQWGLLFKRQAFDEEEYIDLMNIIMEKIVEQSFDKPDLILFSALV
SLYDNDIIEEDVIYKWWDNVSTDPRYDEVKKLTVKWVEWLQNADEESSSEEE
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atggctggaaaaaagggacaaaagaaaagtggactaggcaaccatggaaagaactctgat
atggatgttgaagatcgtctccaggccgttgtcttgacagactcttatgaaactaggttt
atgccactgacagctgtcaagccaaggtgtttgctgccactggctaacgtacctctcatt
gaatacaccttagaatttttggctaaggctggcgtacatgaagttttcttaatttgctct
tctcatgccaaccaaattaatgactatattgagaattctaagtggaacttgccttggtct
ccatttaaaattaccaccattatgtctccagaagctagatgtacgggtgatgttatgaga
gatctagataatagaggtatcattactggagattttattttagtcagtggtgatgtattg
actaacatcgatttcagcaaaatgctagaatttcacaaaaaaatgcatttgcaagataaa
gatcacatctcgacaatgtgtttgagcaaagcgagtacctatccaaaaacaagaactatt
gagcctgccgcatttgtcttagacaaatccaccagtaggtgtatttattaccaagattta
ccattaccaagctctagagagaagacttccattcagattgacccagaattgttggataat
gtcgatgaatttgtcataaggaatgacctcatcgattgtagaattgacatttgtacatct
catgtacctttgatatttcaagaaaattttgactaccaatcattaaggacagactttgtt
aaaggtgtcatttcaagcgatatattgggaaagcatatatatgcctatttgacggacgaa
tatgctgtaagagttgaaagttggcaaacttacgacaccatttctcaagactttttaggt
agatggtgttatcccttggtcttagactctaacatacaggacgatcaaacgtattcttat
gaatcaagacatatatacaaggaaaaagacgttgttttggcccaatcctgtaaaattggt
aagtgcactgcaattggatcaggaacaaaaatcggagagggtacgaaaattgagaattcc
gtgattggaaggaactgccaaatcggtgaaaatattagaatcaagaacagtttcatttgg
gatgactgtatcatcggaaataacagtataattgaccattcattaattgcctctaatgcc
acgttagggagtaatgtacgcctaaatgatggctgtataattggtttcaacgttaaaatt
gatgataatatggatttagatagaaacacaaaaatatctgccagtccattaaaaaatgcc
ggctcaagaatgtatgataatgaaagcaatgagcagtttgaccaagaccttgatgatcag
acactagccgtttctattgttggagataagggtgttggttatatttacgaaagcgaggtg
tctgacgatgaagatagttctacagaagcctgcaaagaaataaacactttgagtaaccaa
ttagatgagttatacttaagtgacgattcaatttcttccgccactaaaaagacaaagaaa
agaagaacgatgtctgtcaatagtatatacacggatagagaagaaattgattctgaattt
gaggacgaagattttgagaaagaaggtattgccaccgtggagcgtgctatggaaaacaat
catgatcttgacacagcattattagaattgaacaccttgagaatgagtatgaacgtgaca
tatcatgaggtgagaatagcaacaataactgcattattgagaagagtttaccactttatt
gcaactcaaacattaggtcccaaggacgctgtggtgaaggtttttaatcagtggggactg
ttgttcaagagacaagcctttgatgaagaagagtatattgatttgatgaacatcataatg
gaaaaaattgtagaacagagttttgacaaaccggatttgattctatttagtgcattggtt
tctctatacgataatgacataattgaggaggatgtcatttataaatggtgggataatgtt
tctactgaccctcgctatgatgaagtcaagaaattaactgtaaagtgggttgagtggtta
cagaatgctgacgaagaatcttcctcagaagaggaataa

DBGET integrated database retrieval system