KEGG   Saccharomyces cerevisiae (budding yeast): YDR214WHelp
Entry
YDR214W           CDS       T00005                                 

Gene name
AHA1
Definition
Aha1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
IV:892875..893927
Genome map
AA seq 350 aa AA seqDB search
MVVNNPNNWHWVDKNCIGWAKEYFKQKLVGVEAGSVKDKKYAKIKSVSSIEGDCEVNQRK
GKVISLFDLKITVLIEGHVDSKDGSALPFEGSINVPEVAFDSEASSYQFDISIFKETSEL
SEAKPLIRSELLPKLRQIFQQFGKDLLATHGNDIQVPESQVKSNYTRGNQKSSFTEIKDS
ASKPKKNALPSSTSTSAPVSSTNKVPQNGSGNSTSIYLEPTFNVPSSELYETFLDKQRIL
AWTRSAQFFNSGPKLETKEKFELFGGNVISELVSCEKDKKLVFHWKLKDWSAPFNSTIEM
TFHESQEFHETKLQVKWTGIPVGEEDRVRANFEEYYVRSIKLTFGFGAVL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtgaataacccaaataactggcactgggtcgataagaactgcatcggatgggcc
aaggagtatttcaaacagaaactggttggagtggaggccggttcggtgaaggataaaaag
tatgccaaaatcaagtctgtttcgtccattgaaggtgattgtgaagttaatcagcgtaag
gggaaggttatatctttgtttgatttgaaaatcacggtgttaatagagggacacgtggac
tctaaggacggatcggcattgccattcgagggtagcattaacgttcctgaagttgccttc
gatagcgaggcctcaagctatcaatttgacatatctatatttaaggagactagcgaattg
agtgaagccaagccactaattagatccgagttattgcccaagttgagacaaattttccaa
caatttggcaaggatttgctggccacccatggtaatgacattcaggtgcccgaatctcag
gtgaaatctaactacacaagaggtaaccaaaaaagtagctttaccgaaatcaaggactcc
gcttcaaagccaaaaaagaatgcacttccctcttctacttcaacttcagcaccagtctcc
agcaccaacaaagtcccccaaaacggaagcggcaatagtacatctatttatttagaacca
acttttaatgtgccttcctccgagctctacgaaacgttccttgataagcaacgcatattg
gcctggaccagatcagcacaatttttcaacagcggaccgaagctggagaccaaagaaaaa
ttcgagctctttggcggcaacgtgatcagcgagttggtttcatgcgaaaaggacaagaaa
cttgttttccactggaaactcaaggattggtctgcccctttcaactctactatcgaaatg
actttccatgagtcgcaagaattccatgaaaccaaattacaggtgaagtggactggcata
cccgttggcgaggaagatcgcgtgcgcgctaattttgaagaatactacgtgcgttctatt
aaattgacattcggctttggtgccgtattataa

DBGET integrated database retrieval system