KEGG   Saccharomyces cerevisiae (budding yeast): YDR214WHelp
Entry
YDR214W           CDS       T00005                                 

Gene name
AHA1
Definition
(RefSeq) Aha1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aha1_N AHSA1 DUF515
Motif
Other DBs
NCBI-GeneID: 851800
NCBI-ProteinID: NP_010500
SGD: S000002622
UniProt: Q12449
Structure
PDB: 

Jmol
Position
IV:892875..893927
Genome map
AA seq 350 aa AA seqDB search
MVVNNPNNWHWVDKNCIGWAKEYFKQKLVGVEAGSVKDKKYAKIKSVSSIEGDCEVNQRK
GKVISLFDLKITVLIEGHVDSKDGSALPFEGSINVPEVAFDSEASSYQFDISIFKETSEL
SEAKPLIRSELLPKLRQIFQQFGKDLLATHGNDIQVPESQVKSNYTRGNQKSSFTEIKDS
ASKPKKNALPSSTSTSAPVSSTNKVPQNGSGNSTSIYLEPTFNVPSSELYETFLDKQRIL
AWTRSAQFFNSGPKLETKEKFELFGGNVISELVSCEKDKKLVFHWKLKDWSAPFNSTIEM
TFHESQEFHETKLQVKWTGIPVGEEDRVRANFEEYYVRSIKLTFGFGAVL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtgaataacccaaataactggcactgggtcgataagaactgcatcggatgggcc
aaggagtatttcaaacagaaactggttggagtggaggccggttcggtgaaggataaaaag
tatgccaaaatcaagtctgtttcgtccattgaaggtgattgtgaagttaatcagcgtaag
gggaaggttatatctttgtttgatttgaaaatcacggtgttaatagagggacacgtggac
tctaaggacggatcggcattgccattcgagggtagcattaacgttcctgaagttgccttc
gatagcgaggcctcaagctatcaatttgacatatctatatttaaggagactagcgaattg
agtgaagccaagccactaattagatccgagttattgcccaagttgagacaaattttccaa
caatttggcaaggatttgctggccacccatggtaatgacattcaggtgcccgaatctcag
gtgaaatctaactacacaagaggtaaccaaaaaagtagctttaccgaaatcaaggactcc
gcttcaaagccaaaaaagaatgcacttccctcttctacttcaacttcagcaccagtctcc
agcaccaacaaagtcccccaaaacggaagcggcaatagtacatctatttatttagaacca
acttttaatgtgccttcctccgagctctacgaaacgttccttgataagcaacgcatattg
gcctggaccagatcagcacaatttttcaacagcggaccgaagctggagaccaaagaaaaa
ttcgagctctttggcggcaacgtgatcagcgagttggtttcatgcgaaaaggacaagaaa
cttgttttccactggaaactcaaggattggtctgcccctttcaactctactatcgaaatg
actttccatgagtcgcaagaattccatgaaaccaaattacaggtgaagtggactggcata
cccgttggcgaggaagatcgcgtgcgcgctaattttgaagaatactacgtgcgttctatt
aaattgacattcggctttggtgccgtattataa

DBGET integrated database retrieval system