KEGG   Saccharomyces cerevisiae (budding yeast): YDR217CHelp
Entry
YDR217C           CDS       T00005                                 

Gene name
RAD9
Definition
Rad9p
Orthology
K06661  
DNA repair protein RAD9
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YDR217C (RAD9)
   04113 Meiosis - yeast
    YDR217C (RAD9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:complement(899551..903480)
Genome map
AA seq 1309 aa AA seqDB search
MSGQLVQWKSSPDRVTQSAIKEALHSPLADGDMNEMNVPVDPLENKVNSTNIIEGSPKAN
PNPVKFMNTSEIFQKSLGLLDESPRHDDELNIEVGDNDRPNANILHNERTPDLDRIANFF
KSNRTPGKENLLTKYQSSDLEDTPLMLRKKMTFQTPTDPLEQKTFKKLKSDTGFCYYGEQ
NDGEENASLEVTEADATFVQMAERSADNYDCALEGIVTPKRYKDELSKSGGMQDERVQKT
QIMISAESPNSISSYDKNKITGNGRTTRNVNKVFNNNEDNIGAIEEKNPVKKKSENYSSD
DLRERNNQIIQSNESEEINELEKNLNVSGRENDVNNLDIDINSAVSGTPSRNNAEEEMYS
SESVNNREPSKKWIFRYSKDKTENNSNRSTQIVNNPRTQEMPLDSISIDTQPLSKSFNTE
TNNELETQIIVSSLSQGISAQKGPVFHSTGQTEEIKTQIINSPEQNALNATFETPVTLSR
INFEPILEVPETSSPSKNTMSKPSNSSPIPKEKDTFNIHEREVETNNVFSNDIQNSSNAA
TRDDIIIAGSSDFNEQKEITDRIYLQLSGKQISDSGSDETERMSPNELDTKKESTIMSEV
ELTQELPEVEEQQDLQTSPKKLVVEEETLMEIKKSKGNSLQLHDDNKECNSDKQDGTESL
DVALIEHESKGQSSELQKNLMQLFPSESQEIIQNRRTIKRRQKDTIEIGEEEENRSTKTS
PTKHLKRNSDLDAASIKREPSCSITIQTGETGSGKDSKEQSYVFPEGIRTADNSFLSKDD
IIFGNAVWCQYTWNYKFYPGILLEVDTNQDGCWIYFETGRSLTKDEDIYYLDIRIGDAVT
FDGNEYVVVGLECRSHDLNIIRCIRGYDTVHLKKKNASGLLGKRTLIKALSSISLDLSEW
AKRAKIILEDNEKNKGDAYRYLRHPIRGRKSMTNVLSPKKHTDDEKDINTHTEVYNNEIE
SSSEKKEIVKKDSRDALAEHAGAPSLLFSSGEIRTGNVFDKCIFVLTSLFENREELRQTI
ESQGGTVIESGFSTLFNFTHPLAKSLVNKGNTDNIRELALKLAWKPHSLFADCRFACLIT
KRHLRSLKYLETLALGWPTLHWKFISACIEKKRIVPHLIYQYLLPSGESFRLSLDSPSKG
GIIKSNNIFSFYTQFLRGSNLRDQICGVKKMLNDYIVIVWGRSELDSFVKFAFACLSAGR
MLTIDLPNIDVDDTEPLLNALDSLVPRIGSELSNRKLKFLIYANENNGKSQMKLLERLRS
QISLKFKKFNYIFHTESKEWLIQTIINEDTGFHDDITDNDIYNTISEVR
NT seq 3930 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggccagttagttcaatggaaaagctctccagatcgagtcacccaaagcgctata
aaggaagcactgcattctcccttggctgatggcgacatgaacgaaatgaatgttcccgtt
gatccgttggaaaacaaggtaaatagcacaaacataatcgaaggaagtcccaaagcaaat
ccaaatcctgtcaagtttatgaatacaagtgagatatttcaaaaatctctgggattactt
gacgagagtccaagacatgatgatgagttaaatattgaagtaggagataatgatcgacca
aatgctaacatattgcataatgaaaggactcctgaccttgaccgaattgctaactttttc
aaaagcaatcgaacccctggtaaagaaaatcttttgaccaaatatcaaagctccgatctg
gaagacactcctctgatgttaagaaaaaaaatgacttttcaaactccaactgatccattg
gaacagaaaaccttcaaaaagttgaagtcagatactgggttttgctattatggagagcag
aatgatggagaagaaaatgcgtcattagaagttacagaggcggatgccacttttgtacag
atggctgaacgttctgctgataattatgactgtgcattggaaggaattgttacacctaaa
agatataaagacgaattaagtaaaagtggaggaatgcaagatgaacgagttcaaaaaact
caaatcatgatatcagcagaatcacctaattcgataagctcttatgacaagaacaaaatt
accgggaatggccggaccacaagaaatgtaaacaaggtttttaacaataacgaagataac
ataggagctatcgaggaaaaaaatccagtaaaaaagaaaagtgagaactattcatcagat
gatctcagagaacggaacaatcaaataatacaaagtaatgaatcagaggagattaacgaa
ttggaaaagaatctgaatgtttcgggtagagagaatgacgtgaacaatttagatatcgat
attaatagtgctgtgtctggcaccccttcacgcaacaatgcggaagaagaaatgtattcc
agtgagagtgtaaacaatcgggaaccatccaagaagtggatattccgatactcaaaagac
aaaacggaaaataatagcaatagatctacgcaaatagtcaataatccaagaacacaggaa
atgcctttagatagtatttcaatcgatacgcaacccttatctaaaagtttcaataccgaa
acaaataatgaattagagacacagataattgtttcatcgctttcccaaggcatatctgct
cagaagggacctgtttttcattctactggccagacagaagaaataaaaacccaaataata
aattctcctgaacaaaatgctttgaatgcaacctttgaaactcccgttactctttctcgg
attaattttgaacccatattggaagttcctgagactagttcaccatctaagaatacgatg
tcaaaaccctcgaattcttcacctattccgaaggaaaaagatacatttaatatacacgag
agagaagtagagacaaacaatgttttttcaaacgatatacaaaattcttcaaatgcagct
accagagatgacattatcatagccggttcatctgatttcaacgaacaaaaggaaataacc
gatagaatatacttacaactttcaggaaagcaaatatctgattcaggaagtgatgaaaca
gaacgtatgtccccaaatgagcttgatacgaaaaaggaaagtacaatcatgagcgaggtt
gaactaacccaagaactgcctgaagttgaagagcagcaagatcttcaaacgtctccaaaa
aagctggtagtcgaggaagaaactttaatggagataaaaaaaagcaaggggaactcactt
cagcttcatgatgataataaagaatgcaattcagataaacaagatggcacagagtctttg
gatgtagctttgattgaacacgaaagcaaaggacagagctcagaacttcagaaaaacctc
atgcaattatttccaagtgagtcacaggagattattcagaaccgaagaacaataaagcga
cgtcaaaaagatacaatagagatcggtgaagaggaggagaacagaagcactaagacatca
ccgacaaaacacctcaaaagaaattcagatttggatgctgcttctatcaaaagggaaccg
tcttgcagcattaccatacaaacaggggagacaggttcgggcaaagactctaaagaacag
tcttacgtgtttcctgaaggtattagaacggcagataatagtttcttatcgaaagacgac
ataatttttggaaatgcggtatggtgtcagtatacgtggaattacaaattttatccgggt
attttattggaagttgacactaatcaagatggctgttggatttatttcgaaacaggaaga
tcgctaaccaaagatgaggacatctactacttagatattagaataggggatgctgttacc
tttgatggaaatgagtacgtagtcgttggtctagaatgtcgtagccatgatctcaacata
ataagatgtattcgaggatatgatacggttcatttgaaaaaaaaaaatgcaagcggattg
ttggggaaaaggacgttaattaaagcactaagctcgatcagtcttgacctaagcgagtgg
gctaaaagagcgaagatcatattagaagataatgagaaaaataaaggcgacgcgtatagg
tacttgagacatcccattaggggaaggaaatcaatgaccaatgttctgtctccgaagaaa
catactgatgacgaaaaggacataaatacgcatactgaagtgtacaataacgaaatagaa
tcgagctccgaaaagaaggaaattgttaaaaaggattctagagacgcattagctgaacat
gcaggagcgccaagcctgcttttttcttctggtgaaatcagaacagggaatgtatttgat
aaatgtatttttgttttgacaagcctattcgaaaatagagaggaacttcgacagaccatt
gaatcgcaaggcggcactgtaattgagtcaggattttccactttatttaacttcactcat
ccgctagctaaatctttagtcaataaaggtaatacagataatattcgagaattggccttg
aagctagcctggaaacctcattccctatttgcagactgcagatttgcttgcctaatcaca
aaacggcatttaagaagcttaaagtacttagaaactttggcgttggggtggcctacacta
cactggaaattcataagtgcatgcattgaaaagaaaagaatagtaccacatttaatatac
caatacctattaccttcgggtgaaagttttcggttatcgttagattctccatcaaaggga
ggaatcattaaatccaacaatattttttcattttatacacaattcttacgcggatctaat
ttaagagatcagatatgtggagtgaagaaaatgttaaatgactacattgttattgtttgg
ggtagatctgagttggacagttttgtcaaatttgcttttgcatgtttgagcgcaggtaga
atgcttacaattgatttacccaatattgatgtagatgatacagagccattgttaaatgcc
ttagattctttagtacccagaataggatcagaattatctaatcgaaagttaaagtttctc
atatatgctaacgaaaataatggtaaatctcagatgaagcttctcgaaagattgagaagt
caaatatcactgaaatttaagaaatttaattacatatttcacactgaatctaaagaatgg
ctaattcagacaataattaacgaggacactggttttcacgatgatattacggacaatgat
atatacaacactatttctgaggttagatga

DBGET integrated database retrieval system