KEGG   Saccharomyces cerevisiae (budding yeast): YDR224CHelp
Entry
YDR224C           CDS       T00005                                 

Gene name
HTB1, SPT12
Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YDR224C (HTB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
IV:complement(914317..914712)
Genome map
AA seq 131 aa AA seqDB search
MSAKAEKKPASKAPAEKKPAAKKTSTSTDGKKRSKARKETYSSYIYKVLKQTHPDTGISQ
KSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTR
AVTKYSSSTQA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctaaagccgaaaagaaaccagcctccaaagccccagctgaaaagaaaccagcc
gctaaaaagacttccacttccactgatggtaagaagagaagcaaggctagaaaggaaaca
tactcttcttacatttacaaagttttgaagcaaactcaccctgacactggtatttcccaa
aagtccatgtctatcttgaactctttcgttaacgatatctttgaaagaatcgctactgaa
gcttctaaattggctgcgtataacaagaagtctactatctctgctagagaaattcaaacc
gctgttagattgatcttaccaggtgaattggctaagcatgctgtctctgaaggtactaga
gctgttaccaagtactcttcctctactcaagcataa

DBGET integrated database retrieval system