KEGG   Saccharomyces cerevisiae (budding yeast): YDR260CHelp
Entry
YDR260C           CDS       T00005                                 

Gene name
SWM1, APC13
Definition
Swm1p
Orthology
K12416  
anaphase-promoting complex subunit SWM1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YDR260C (SWM1)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YDR260C (SWM1)
   04113 Meiosis - yeast
    YDR260C (SWM1)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     YDR260C (SWM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:complement(976717..977229)
Genome map
AA seq 170 aa AA seqDB search
MSSSSYRDSYFQYRHLPAPHHILYAEWNQDILALPDEVANITMAMKDNTRTDAEEGRAPQ
DGERNSNVRESAQGKALMTSEQNSNRYWNSFHDEDDWNLFNGMELESNGVVTFAGQAFDH
SLNGGTNSRNDGANEPRKETITGSIFDRRITQLAYARNNGWHELALPQSR
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaagttcttatagggattcatattttcaataccgccatttaccagcaccacat
cacatattatatgcggaatggaatcaagatatactggcgcttccggacgaagtggcaaat
attacaatggctatgaaagataatactcgcaccgacgcggaggagggaagagctccccaa
gatggggaaaggaattctaatgtacgcgagagcgctcaaggtaaggcattaatgacaagt
gaacaaaatagcaaccgctactggaactcttttcatgatgaagacgattggaatctattc
aatggcatggaactggagagtaatggagtagtgacgtttgctggacaggcgttcgatcat
tctttaaacgggggaaccaattccaggaacgacggtgccaatgagccaagaaaagaaacg
ataactggttctatttttgataggcgcatcacacaattggcgtacgcaagaaataacggt
tggcacgaactggctctcccacagtcacgatga

DBGET integrated database retrieval system