KEGG   Saccharomyces cerevisiae (budding yeast): YDR307WHelp
Entry
YDR307W           CDS       T00005                                 

Gene name
PMT7
Definition
(RefSeq) putative dolichyl-phosphate-mannose--protein mannosyltransferase
  KO
K00728  dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00514  Other types of O-glycan biosynthesis
sce00515  Mannose type O-glycan biosynthesis
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    YDR307W (PMT7)
   00514 Other types of O-glycan biosynthesis
    YDR307W (PMT7)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     YDR307W (PMT7)
Glycosyltransferases [BR:sce01003]
 O-Glycan biosynthesis
  O-linked Man type
   YDR307W (PMT7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIR PMT ST7 EII-Sor
Motif
Other DBs
NCBI-GeneID: 851902
NCBI-ProteinID: NP_010593
SGD: S000002715
UniProt: Q06644
Position
IV:1075865..1077853
Genome map
AA seq 662 aa AA seqDB search
MKDLRLQGPYRKYIPYNIFQQCGIGHLKTLDYIFAFLIVITNFTLIWKSHSSSFWNRPWD
NNSEQELSQLIQFYLDKAFYIHELPPFTIQFYSIIRRLKIAENLRYVSLFLNSSTLGFLF
LITRRINCSRLISATGLLILSNWETFRNEGTIISFDSLEWCLFSVVIYSFISISIAKLGT
TNWFANVITLSISLGLAISSKFIGIVTWAFVILSFVRQFDRLISDVKVTTIQIIKFVILC
LLFVLIIPGSIFIISYSNLLSNFKTDTPQFSKYMSTYFKSYLRGPQVQPSRLYYGSTITL
RHLDSMVGYLASHDISYPSDVDEQLVALSFEEFAADNEWLIEHPTLNLSFSEVYHADQLI
PVEFGQSIKLRHKSTGKLLRASTAKPPISEQDYDFQISCTKDSNYEGGMDERWDVLLIKD
EINNDKKDNADDKYIKPLQSEIRFYNNGQRCGLLGHDLRLPEWGRFEQEVLCMEYPVIPR
TTFLIDSVQLPVDFQVPMIEYYIGKISSSAEFNHTLSWSQFLYLFKEYIFKQYKYNYYIK
YGKNKVTFEDAFAVEKWPITLDTDSPVWFNFAWYGSLLSMIIFMCVQCKRMISWNPWTTA
EPSFSIKWEVYNEFGWECIVGWFLHFYIFTMSPHFNLGKKLYFQSFFFSVLCLLESLDCL
AK
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacttgagattacaggggccctacagaaagtacattccctataatattttccaa
caatgtggaattggtcacttaaagacgcttgattatattttcgcgtttttgattgttatt
accaatttcacattaatatggaaatcgcactcttcttcattctggaaccgaccatgggac
aataatagtgaacaagaactttcccaattaattcagttttacctagacaaggctttttac
atccatgaattgccaccatttacaatacagttctactccattattcgaagattaaagatc
gcagaaaatttaagatacgtttctttgtttttgaattcatcgactttaggttttcttttc
ctgataacaaggagaatcaattgctctcgtttaatttcagcaacaggtttgctgatatta
tccaactgggaaactttcagaaatgagggcactattatatcatttgacagtttagaatgg
tgtctgttctcagtagtaatttacagttttataagcatttcaattgcaaaactgggaact
acgaattggtttgctaatgtgattacattatctatttctttagggctggcaatctcttct
aaatttattggaattgtcacttgggccttcgtaattctttcttttgtacgtcaatttgat
agactgataagcgacgttaaagttacgaccatccaaataataaaatttgtcattctctgt
ctattattcgttttgattatccctggttccatcttcataataagttattcgaacttactt
tcgaattttaagacagacacgccacaattttcaaaatatatgagcacatatttcaagtcc
tatttaagaggccctcaagtacaaccgagtcgattgtactatggatcaacgatcacatta
cgtcatttagattctatggtcggatatcttgcttctcacgatatttcgtatccatcagat
gttgacgaacagttagtagcgttatcatttgaagaattcgcggcagacaatgaatggtta
atagaacatcctacattaaatttgagtttttctgaggtataccatgctgatcaattgata
cctgtagaatttggtcaaagtataaaactaagacacaaatctactggaaaattattgaga
gccagcactgctaaacctcccatcagcgagcaggactatgactttcaaatttcatgcacg
aaagattcaaactacgaaggaggaatggatgagagatgggatgttctcctgattaaagat
gaaatcaacaatgataaaaaggataacgcagatgataaatacattaaaccgcttcaatca
gagatacgcttttacaataacggccagagatgtgggctattgggccatgatcttcggtta
cctgaatggggccgctttgagcaagaagtcctatgtatggagtacccagtaataccaaga
accacttttctaatagactcagtacaactaccagtcgatttccaagtcccaatgatagaa
tattatatcggcaaaataagttcttcagcagaattcaatcataccttatcttggtcacaa
tttctttatcttttcaaagaatatattttcaaacaatacaagtacaattactatattaaa
tacggtaaaaataaggtcacttttgaagatgcgttcgccgtggaaaaatggccaattacg
ttagacacagactctccagtttggtttaattttgcatggtatggatccttactctcgatg
atcattttcatgtgcgtgcaatgtaagagaatgatatcttggaatccgtggacaactgct
gaaccttccttttctatcaaatgggaggtctacaatgaatttggctgggagtgcattgtc
ggttggtttttacatttttacatcttcacaatgagtccacacttcaacttggggaaaaaa
ctgtacttccaaagttttttctttagtgtattgtgtcttttagaatcgttagattgcctt
gcaaagtaa

DBGET integrated database retrieval system