KEGG   Saccharomyces cerevisiae (budding yeast): YDR325WHelp
Entry
YDR325W           CDS       T00005                                 

Gene name
YCG1, TIE1, YCS5
Definition
Ycg1p
Orthology
K06678  
condensin complex subunit 3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YDR325W (YCG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:1117126..1120233
Genome map
AA seq 1035 aa AA seqDB search
MQDPDGIDINTKIFNSVAEVFQKAQGSYAGHRKHIAVLKKIQSKAVEQGYEDAFNFWFDK
LVTKILPLKKNEIIGDRIVKLVAAFIASLERELILAKKQNYKLTNDEEGIFSRFVDQFIR
HVLRGVESPDKNVRFRVLQLLAVIMDNIGEIDESLFNLLILSLNKRIYDREPTVRIQAVF
CLTKFQDEEQTEHLTELSDNEENFEATRTLVASIQNDPSAEVRRAAMLNLINDNNTRPYI
LERARDVNIVNRRLVYSRILKSMGRKCFDDIEPHIFDQLIEWGLEDRELSVRNACKRLIA
HDWLNALDGDLIELLEKLDVSRSSVCVKAIEALFQSRPDILSKIKFPESIWKDFTVEIAF
LFRAIYLYCLDNNITEMLEENFPEASKLSEHLNHYILLRYHHNDISNDSQSHFDYNTLEF
IIEQLSIAAERYDYSDEVGRRSMLTVVRNMLALTTLSEPLIKIGIRVMKSLSINEKDFVT
MAIEIINDIRDDDIEKQEQEEKIKSKKINRRNETSVDEEDENGTHNDEVNEDEEDDNISS
FHSAVENLVQGNGNVSESDIINNLPPEKEASSATIVLCLTRSSYMLELVNTPLTENILIA
SLMDTLITPAVRNTAPNIRELGVKNLGLCCLLDVKLAIDNMYILGMCVSKGNASLKYIAL
QVIVDIFSVHGNTVVDGEGKVDSISLHKIFYKVLKNNGLPECQVIAAEGLCKLFLADVFT
DDDLFETLVLSYFSPINSSNEALVQAFAFCIPVYCFSHPAHQQRMSRTAADILLRLCVLW
DDLQSSVIPEVDREAMLKPNIIFQQLLFWTDPRNLVNQTGSTKKDTVQLTFLIDVLKIYA
QIEKKEIKKMIITNINAIFLSSEQDYSTLKELLEYSDDIAENDNLDNVSKNALDKLRNNL
NSLIEEINERSETQTKDENNTANDQYSSILGNSFNKSSNDTIEHAADITDGNNTELTKTT
VNISAVDNTTEQSNSRKRTRSEAEQIDTSKNLENMSIQDTSTVAKNVSFVLPDEKSDAMS
IDEEDKDSESFSEVC
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatcctgatggtattgacattaatacgaaaatctttaactcagttgctgaagta
tttcaaaaggcacagggttcttatgcaggacacaggaagcatatagcagttttgaagaaa
attcagtcaaaggctgttgagcaaggctatgaagatgcttttaacttttggttcgataaa
ttagttactaagatccttcctctgaaaaagaatgagattatcggagacaggatagtaaag
ttagtagctgcatttatagcttctttagaaagggagttgatattggccaaaaaacaaaac
tataagctcacgaatgatgaagaagggatattctcaaggttcgtcgatcagttcataaga
catgttttgcgtggtgtggaaagccctgacaagaacgtcagatttagagttttacagtta
ttagccgttataatggataatataggggaaatcgatgaatcacttttcaatttattaata
ttgtctttaaataagaggatttatgatagagaaccaacggttaggatacaggctgtgttt
tgtttaactaaatttcaggatgaagagcaaactgaacatttaactgagctttctgataat
gaagaaaattttgaagctacgagaactctagttgcttctatccagaacgatccgtcagct
gaagtacggagggctgcaatgctgaatttgatcaatgataataatactagaccgtatatc
ttggagagggctagagatgtaaacatcgttaatagaaggctcgtgtattcgagaattttg
aaatcaatgggaagaaagtgtttcgatgatattgagccgcatatttttgatcaattgatt
gagtggggtttagaagatagggaattatcagtgagaaatgcgtgtaagagactcattgct
catgattggttaaatgctctggatggcgatttgatagaattactagaaaaattggatgtc
tcaagatcctcagtgtgtgttaaggctatagaagcactttttcaatcaaggccagatata
ttatctaaaatcaaatttcctgaaagtatttggaaagactttaccgtagaaattgccttc
ctctttcgggctatttatttgtactgtttggataataatataacagaaatgctggaagaa
aactttccagaagcctcaaaattatccgagcatttaaaccattatattcttctcagatat
catcacaacgacatttctaatgactctcagtcgcattttgattataacactttagagttt
attattgagcaactatcgattgccgccgaaaggtatgattatagcgatgaggttggaagg
agatcgatgcttacagtggtacgaaatatgctggccttaactacactctccgaacctctt
attaaaattggtattcgtgtaatgaaaagtctgtccataaatgaaaaagattttgtaaca
atggcaatagaaatcattaatgatattagagacgacgatattgaaaaacaagaacaagaa
gagaaaataaaaagcaagaagattaatcgcagaaatgagacttccgtcgatgaagaggac
gaaaacggcacacataatgacgaagttaacgaggatgaagaagacgacaatatttcatcc
ttccattctgctgtagaaaacttagtgcagggaaacggcaacgtatctgagagtgacata
ataaataatctcccacccgaaaaggaagcgtcctcagcaacaattgttctctgtcttaca
aggtcatcatatatgctagaactagttaacacaccgttaacagaaaacattttaattgcg
tcgttgatggacactttgatcacaccagcggttagaaataccgcgccaaatattagggag
cttggtgtcaagaaccttggtttatgttgtctcttggatgtgaagttggctattgataac
atgtacatcttaggtatgtgcgtttcgaaaggtaatgcatcattaaagtatattgcgtta
caagtcattgtagatattttttccgtacatgggaacactgtggtagacggagaaggcaaa
gttgactcaatctcgttgcacaaaatattttacaaggttttaaagaataacggtttaccg
gaatgtcaggtgatagcagcggagggtttatgcaaactatttttggcagacgtgttcact
gatgatgatttgtttgaaacgttggttttgtcatatttttcgccgataaattcctcaaac
gaagcgctggtacaggcatttgccttctgcattccagtctattgtttttcacatcctgct
catcaacaacgtatgtctaggacggctgcggacatactcttaagactatgtgttctttgg
gacgatttacagagctctgtaatacctgaggtagaccgtgaagctatgctaaagcctaac
ataatatttcaacagttgctattttggactgatccacgtaacttagttaaccagacaggt
tcaacaaaaaaagatacagtgcagcttacattcttgatcgatgtgctcaaaatatacgct
caaattgagaagaaagaaataaagaagatgatcatcactaatataaacgctatatttctt
tcttctgaacaagattattctactttgaaagaacttcttgagtattctgacgatattgca
gaaaatgataatttagacaatgttagcaaaaatgctctggacaagctaaggaataatttg
aattcgctgattgaagagatcaatgaaaggtcagaaactcagacaaaagatgagaacaac
actgcgaatgaccaatactcgtctattttggggaattcattcaataaatcttcaaatgac
accatagaacacgctgctgatataactgatggaaataacacagaattgactaaaacaact
gttaatatttcggcagttgacaatacaacagagcaaagtaactcaaggaaaagaacgaga
tcagaagcggagcaaattgacacatccaaaaacctggaaaacatgagtattcaagacacg
tcaactgtagcaaaaaatgtaagttttgttttacctgacgagaaatcagatgcaatgtcc
atagatgaagaagataaggattcagagtctttcagcgaggtctgttaa

DBGET integrated database retrieval system