KEGG   Saccharomyces cerevisiae (budding yeast): YDR328CHelp
Entry
YDR328C           CDS       T00005                                 

Gene name
SKP1, MGO1
Definition
Skp1p
Orthology
K03094  
S-phase kinase-associated protein 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Module
SCF-MET30 complex
SCF-CDC4 complex
SCF-GRR1 complex
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:sce04141]
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:sce04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:sce04111]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
IV:complement(1125434..1126018)
Genome map
AA seq 194 aa AA seqDB search
MVTSNVVLVSGEGERFTVDKKIAERSLLLKNYLNDMHDSNLQNNSDSESDSDSETNHKSK
DNNNGDDDDEDDDEIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDEDDDDSRKSAPVDSWD
REFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEE
EAAIRRENEWAEDR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggtgacttctaatgttgtcctagtgagtggtgagggtgaacgattcaccgtagacaag
aaaatcgcggagagatccctgctattgaaaaactatctgaacgatatgcatgacagcaac
ctacaaaacaactcagattcagaatcagattcagactcggaaacgaaccacaaaagcaaa
gacaacaataacggtgacgacgacgatgaggatgacgacgagattgtgatgcccgtgccc
aatgttcggtcttccgttttgcagaaggttatcgaatgggccgagcaccacagagactct
aacttccctgacgaagatgacgacgattccagaaagagtgctcccgtggactcatgggac
agagaattcctgaaagtggaccaagagatgctatacgaaattattctggcggcaaactac
ctcaacatcaagcccttgcttgacgctggctgcaaggtggttgctgaaatgatcagggga
aggtctcccgaggaaattagaagaacgtttaatatcgtcaacgacttcactccagaggag
gaggctgccattaggcgtgaaaatgaatgggctgaagaccgttag

DBGET integrated database retrieval system