KEGG   Saccharomyces cerevisiae (budding yeast): YDR328CHelp
Entry
YDR328C           CDS       T00005                                 

Gene name
SKP1, MGO1
Definition
(RefSeq) SCF ubiquitin ligase subunit SKP1
  KO
K03094  
S-phase kinase-associated protein 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Module
SCF-MET30 complex
SCF-CDC4 complex
SCF-GRR1 complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YDR328C (SKP1)
   04120 Ubiquitin mediated proteolysis
    YDR328C (SKP1)
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YDR328C (SKP1)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     YDR328C (SKP1)
   Cul7 complex
     YDR328C (SKP1)
Chromosome [BR:sce03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     YDR328C (SKP1)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     YDR328C (SKP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
IV:complement(1125434..1126018)
Genome map
AA seq 194 aa AA seqDB search
MVTSNVVLVSGEGERFTVDKKIAERSLLLKNYLNDMHDSNLQNNSDSESDSDSETNHKSK
DNNNGDDDDEDDDEIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDEDDDDSRKSAPVDSWD
REFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEE
EAAIRRENEWAEDR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggtgacttctaatgttgtcctagtgagtggtgagggtgaacgattcaccgtagacaag
aaaatcgcggagagatccctgctattgaaaaactatctgaacgatatgcatgacagcaac
ctacaaaacaactcagattcagaatcagattcagactcggaaacgaaccacaaaagcaaa
gacaacaataacggtgacgacgacgatgaggatgacgacgagattgtgatgcccgtgccc
aatgttcggtcttccgttttgcagaaggttatcgaatgggccgagcaccacagagactct
aacttccctgacgaagatgacgacgattccagaaagagtgctcccgtggactcatgggac
agagaattcctgaaagtggaccaagagatgctatacgaaattattctggcggcaaactac
ctcaacatcaagcccttgcttgacgctggctgcaaggtggttgctgaaatgatcagggga
aggtctcccgaggaaattagaagaacgtttaatatcgtcaacgacttcactccagaggag
gaggctgccattaggcgtgaaaatgaatgggctgaagaccgttag

DBGET integrated database retrieval system