KEGG   Saccharomyces cerevisiae (budding yeast): YDR386WHelp
Entry
YDR386W           CDS       T00005                                 

Gene name
MUS81, SLX3
Definition
(RefSeq) Mus81p
  KO
K08991  
crossover junction endonuclease MUS81 [EC:3.1.22.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sce00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    YDR386W (MUS81)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.-  
     YDR386W (MUS81)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     YDR386W (MUS81)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
SGD: 
UniProt: 
Position
IV:1246084..1247982
Genome map
AA seq 632 aa AA seqDB search
MELSSNLKDLYIEWLQELVDGLTPKQEQLKIAYEKAKRNLQNAEGSFYYPTDLKKVKGIG
NTIIKRLDTKLRNYCKIHHISPVEAPSLTQTSSTRPPKRTTTALRSIVNSCENDKNEAPE
EKGTKKRKTRKYIPKKRSGGYAILLSLLELNAIPRGVSKEQIIEVAGKYSDHCMTPNFST
KEFYGAWSSIAALKKHSLVLEEGRPKRYSLTEEGVELTKSLKTADGISFPKENEEPNEYS
VTRNESSEFTANLTDLRGEYGKEEEPCDINNTSFMLDITFQDLSTPQRLQNNVFKNDRLN
SQTNISSHKLEEVSDDQTVPDSALKAKSTIKRRRYNGVSYELWCSGDFEVFPIIDHREIK
SQSDREFFSRAFERKGMKSEIRQLALGDIIWVAKNKNTGLQCVLNTIVERKRLDDLALSI
RDNRFMEQKNRLEKSGCEHKYYLIEETMSGNIGNMNEALKTALWVILVYYKFSMIRTCNS
DETVEKIHALHTVISHHYSQKDLIVIFPSDLKSKDDYKKVLLQFRREFERKGGIECCHNL
ECFQELMGKGDLKTVGELTIHVLMLVKGISLEKAVAIQEIFPTLNKILMAYKTCSSEEEA
KLLMFNVLGDAPGAKKITKSLSEKIYDAFGKL
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggaactctcatcaaacttaaaagacctatatattgaatggttacaagaattagttgac
ggattaacccctaaacaagaacaactcaaaatagcctatgaaaaagcaaaaaggaattta
caaaatgctgaaggttcattttattatcctacagatctaaagaaagttaagggaattggc
aatacaataataaagagattagatacgaaattacggaactattgcaaaattcaccacata
tctcccgttgaggctccttccttaactcagacaagtagcaccagaccaccaaagaggact
actacagctttgcgtagcatagtaaactcatgcgaaaatgataagaatgaagctcccgaa
gagaagggaactaaaaagagaaaaactaggaagtatatacccaaaaaaagatctggaggc
tacgctatccttctttccttactcgagcttaatgccattcctcgaggcgttagtaaagag
caaatcatcgaggttgcaggaaaatacagtgaccattgtatgactccaaatttctccaca
aaagaattctacggtgcttggtcgtctattgctgcacttaaaaaacattcgttggttctt
gaggaaggtagaccaaaacggtattcgctaacagaggaaggtgtagaactaacaaagagc
ttaaagacggcagacggaatctcttttccaaaagaaaatgaagaacctaacgagtattcc
gtaaccaggaatgaaagtagtgaattcacagcaaatctgactgacctccgtggtgaatat
ggtaaggaagaagagccctgcgatataaataacacttcattcatgctggatataactttt
caagatttgagcacgccgcaaaggctgcagaacaatgtatttaaaaatgatagactgaat
agccaaactaatatatcttctcataaattggaagaggtctctgatgatcaaacagtacct
gattccgcattaaaggctaaaagcacaataaagaggagaaggtacaacggagtaagttac
gaattgtggtgtagtggtgatttcgaagttttcccaattattgatcacagagaaataaag
tcacaatctgatcgtgagtttttttcaagggcatttgaaagaaaaggtatgaagtcagag
ataaggcaactcgctttgggtgatattatatgggttgccaagaataaaaataccgggttg
cagtgtgtgctcaacaccatagttgaaagaaaaaggctagacgatttagctttaagtata
agggataacaggtttatggagcaaaaaaataggttagagaaatctggctgtgaacacaaa
tactatctcattgaggagactatgagtggcaacattggaaatatgaatgaggccctaaag
accgcgctttgggtcattttagtgtattacaaattctccatgataagaacttgcaattcg
gatgaaactgtggaaaagatacatgcgttgcatactgtaatttctcatcactattctcaa
aaagatctcatagttatatttccaagtgaccttaaaagcaaggacgattataaaaaggtg
cttctacagtttcgtcgagaattcgaacgaaaaggcggtattgaatgctgtcataatctt
gaatgctttcaagaactaatgggaaaaggcgatctaaagacggttggtgagctaactata
catgttttaatgcttgttaaaggtatatctttagaaaaagcagtagccatccaagaaata
tttcctaccctgaataaaatactaatggcatataaaacgtgctcctcggaagaagaggct
aaattgttgatgtttaatgtactgggagatgcacctggtgcgaagaaaattactaaatct
ctttcagaaaagatatatgatgcttttggtaaactttag

DBGET integrated database retrieval system