KEGG   Saccharomyces cerevisiae (budding yeast): YDR402CHelp
Entry
YDR402C           CDS       T00005                                 

Gene name
DIT2, CYP56
Definition
Dit2p (EC:1.14.14.-)
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    YDR402C (DIT2)
  Amino acid metabolism
   00380 Tryptophan metabolism
    YDR402C (DIT2)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     YDR402C (DIT2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:complement(1272234..1273703)
Genome map
AA seq 489 aa AA seqDB search
MELLKLLCLILFLTLSYVAFAIIVPPLNFPKNIPTIPFYVVFLPVIFPIDQTELYDLYIR
ESMEKYGAVKFFFGSRWNILVSRSEYLAQIFKDEDTFAKSGNQKKIPYSALAAYTGDNVI
SAYGAVWRNYRNAVTNGLQHFDDAPIFKNAKILCTLIKNRLLEGQTSIPMGPLSQRMALD
NISQVALGFDFGALTHEKNAFHEHLIRIKKQIFHPFFLTFPFLDVLPIPSRKKAFKDVVS
FRELLVKRVQDELVNNYKFEQTTFAASDLIRAHNNEIIDYKQLTDNIVIILVAGHENPQL
LFNSSLYLLAKYSNEWQEKLRKEVNGITDPKGLADLPLLNAFLFEVVRMYPPLSTIINRC
TTKTCKLGAEIVIPKGVYVGYNNFGTSHDPKTWGTTADDFKPERWGSDIETIRKNWRMAK
NRCAVTGFHGGRRACLGEKLALTEMRISLAEMLKQFRWSLDPEWEEKLTPAGPLCPLNLK
LKFNENIME
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggagttgttaaagcttctgtgtttgattttatttcttactctttcctatgtcgccttt
gcaatcattgtcccacctctaaactttcccaaaaatatacccaccatcccattttatgta
gtatttttaccagtaatatttcccattgatcaaacggagctatacgatctttatattagg
gaatcaatggaaaaatacggtgctgtaaaatttttctttggttcacggtggaatattctc
gtttctcgttctgagtatctagcacaaatattcaaagatgaagatacttttgcgaagagc
ggtaatcaaaagaaaatcccatacagtgctcttgccgcttacacaggggacaatgtcatt
agcgcgtatggtgcagtttggagaaactacagaaatgctgtgacaaacgggctccaacat
tttgacgatgcacctatattcaaaaatgcaaaaattttatgcactttgataaaaaacaga
ctcctagaaggacaaacttcgatccctatgggacctttatcccagagaatggcattggat
aacatttcacaggttgcccttggatttgattttggtgctctaacacatgaaaaaaatgct
ttccacgagcatttgattcgtattaaaaagcaaatatttcatccattctttttaactttt
ccattccttgatgttcttcctattccttcaagaaaaaaagccttcaaggatgttgttagt
tttagagaacttctcgttaaaagagttcaagatgaattagtcaataattacaaatttgaa
caaactacttttgctgccagtgatctaattcgtgctcacaataacgaaataatcgactac
aaacagttgaccgataatatcgtcattatccttgtcgctggccatgaaaacccgcagttg
ctatttaatagttcactctaccttctagccaaatattcaaatgaatggcaagagaaactc
aggaaggaagtaaacggcatcactgatccaaaaggcttagcagatttacccttattaaat
gcttttctcttcgaagtagtaagaatgtatcctcctttgagcacaattattaatagatgt
actaccaaaacgtgcaagttgggggcggaaattgttatacccaagggcgtatatgtcggg
tacaacaactttggaacctcacacgatcccaaaacttggggcacaacagcagatgatttt
aaaccagaaagatggggttcagatatcgaaaccataaggaaaaactggagaatggcgaaa
aacagatgtgctgtgactgggttccatggaggccgaagagcatgcctaggggaaaaacta
gccctaacagaaatgagaatttctttggctgaaatgttgaaacagtttcgatggagtctt
gaccctgaatgggaagaaaaattaactcccgctgggcctctttgccctcttaatttaaag
ttaaaatttaacgagaatataatggaataa

DBGET integrated database retrieval system