KEGG   Saccharomyces cerevisiae (budding yeast): YDR448WHelp
Entry
YDR448W           CDS       T00005                                 

Gene name
ADA2, SWI8
Definition
Ada2p
Orthology
K11314  
transcriptional adapter 2-alpha
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     YDR448W (ADA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
IV:1356065..1357369
Genome map
AA seq 434 aa AA seqDB search
MSNKFHCDVCSADCTNRVRVSCAICPEYDLCVPCFSQGSYTGKHRPYHDYRIIETNSYPI
LCPDWGADEELQLIKGAQTLGLGNWQDIADHIGSRGKEEVKEHYLKYYLESKYYPIPDIT
QNIHVPQDEFLEQRRHRIESFRERPLEPPRKPMASVPSCHEVQGFMPGRLEFETEFENEA
EGPVKDMVFEPDDQPLDIELKFAILDIYNSRLTTRAEKKRLLFENHLMDYRKLQAIDKKR
SKEAKELYNRIKPFARVMTAQDFEEFSKDILEELHCRARIQQLQEWRSNGLTTLEAGLKY
ERDKQARISSFEKFGASTAASLSEGNSRYRSNSAHRSNAEYSQNYSENGGRKKNMTISDI
QHAPDYALLSNDEQQLCIQLKILPKPYLVLKEVMFRELLKTGGNLSKSACRELLNIDPIK
ANRIYDFFQSQNWM
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacaagtttcactgtgacgtttgttcagctgattgcacgaacagagtgagggtt
tcatgtgctatttgtcccgaatacgacttatgcgtgccctgcttttcacaaggctcgtat
acaggaaagcatcgcccttaccatgattataggataatagagaccaattcataccccatt
ctctgtcctgattggggtgccgatgaagaattgcagttgattaaaggcgcacagacttta
gggctcggtaattggcaggatattgctgaccatataggcagcagaggcaaagaagaagtt
aaggaacattacctaaaatattatctggaaagcaaatactatccaatacctgatattacc
caaaatatacatgtcccacaagatgaatttttggaacagcgaaggcatagaatcgagtcc
ttccgggagaggccgctagagcctccaagaaagcccatggcatcggttcctagctgccat
gaagtacaggggtttatgccgggcagattagaatttgaaacagaattcgaaaatgaagct
gaaggtcccgtaaaggatatggtttttgaacctgatgaccagcccttagacattgaattg
aagtttgccatcttggacatttacaattctagattgacaaccagagcagaaaagaaaagg
ctattatttgaaaaccatttaatggattacagaaagttgcaagctattgacaaaaagagg
agcaaagaagccaaagaattgtataaccgcataaaaccttttgctcgtgttatgactgca
caggattttgaggaatttagcaaggatatattagaagaattgcattgcagggcaagaata
cagcaattacaagaatggagaagcaatgggttaaccacgttagaagcaggtcttaagtat
gaacgagataagcaagctagaattagcagtttcgagaaatttggcgcttctacggcggcg
tcactcagtgagggcaatagccgttataggtcgaattctgcacataggtcgaacgcagaa
tacagccaaaactacagcgaaaatggcggtagaaagaaaaatatgaccattagcgatata
cagcatgcacctgactatgcactgttgtccaacgacgagcagcaactttgtattcaactg
aaaattttacctaaaccgtatctcgttctaaaagaggtaatgttcagagaactgttgaag
actgggggtaatctaagcaaaagcgcatgtagggaactacttaatatagaccccataaaa
gcgaatagaatatacgattttttccagagccagaattggatgtaa

DBGET integrated database retrieval system