KEGG   Saccharomyces cerevisiae (budding yeast): YDR451CHelp
Entry
YDR451C           CDS       T00005                                 

Gene name
YHP1
Definition
(RefSeq) Yhp1p
  KO
K12411  homeobox protein YOX1/YHP1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YDR451C (YHP1)
Transcription factors [BR:sce03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, not assigned
    YDR451C (YHP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Homeobox Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 852062
NCBI-ProteinID: NP_010739
SGD: S000002859
UniProt: Q04116
Position
IV:complement(1361120..1362181)
Genome map
AA seq 353 aa AA seqDB search
MESRNTVLPSLPNIITGTSNSPFQLHTLPNTNFPSDDQGDIRLPPLAASAHIVRPVVNIY
KSPCDEERPKRKSPQAVDFLSQRVTTSMTPLSKPKKLSSHSPFTPTVRVCSKEQPPQSMH
SYKKVNILTPLSAAKAVLTPTTRKEKKRSFAFITHSQETFPKKEPKIDNARLARRKRRRT
SSYELGILQTAFDECPTPNKAKRIELSEQCNMSEKSVQIWFQNKRQAAKKHKNSGNTSHC
KVHSNDSMSMISYSDAALEITSTPTSTKEAITAELLKTSPANTSSIFEDHHITPCKPGGQ
LKFHRKSVLVKRTLSNTGHSEIIKSPKGKENRLKFNAYERKPLGEVDLNSFKN
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcagaaataccgtgcttccttctttaccaaacattattacaggtacttctaat
tcgcctttccaactgcatactttgccaaatacaaacttccctagtgatgaccaaggtgac
atcaggttgccaccattagctgcatctgcgcacattgtgagaccagtggtaaatatttat
aaaagtccttgcgatgaggaaaggccaaaaaggaaaagtccacaggctgtggatttctta
tcacaacgtgtaaccacttccatgacgcctttatccaagcccaagaagctgagctctcat
tcaccattcacgccaacggtcagagtctgttctaaagagcagccacctcagagtatgcac
tcttataaaaaagttaatattcttactcctctatctgctgcaaaggctgttctcacacca
accacaagaaaagaaaagaaaaggtcatttgcctttattacacactcacaggaaactttt
ccaaagaaggagcctaagatagacaatgctcggttagctcgtcggaaaagaagaagaact
tcatcatatgagcttgggatattgcaaacagcatttgacgaatgtcccacgcccaataag
gctaaaaggatagagttatccgagcaatgtaatatgtccgaaaaatcggttcaaatatgg
tttcagaacaaaaggcaggctgctaaaaagcacaagaacagtggcaacaccagccattgc
aaagttcactctaatgattcgatgtctatgatatcttactcagacgctgcgttggaaatt
acctctacgccaacgagtacgaaggaggctattactgcagagttgctgaaaacttcacct
gccaatacgtcctcgatcttcgaagaccaccacataacgccttgcaagcccggcggacag
ctcaagttccacaggaaatctgtgcttgttaagagaacattatcaaataccggtcatagc
gagattatcaaaagtcctaaaggcaaggaaaaccgcctaaagttcaatgcatacgaaaga
aaaccccttggggaggtcgatctcaattctttcaaaaactaa

DBGET integrated database retrieval system