KEGG   Saccharomyces cerevisiae (budding yeast): YDR451CHelp
Entry
YDR451C           CDS       T00005                                 

Gene name
YHP1
Definition
Yhp1p
Orthology
K12411  
homeobox protein YOX1/YHP1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YDR451C (YHP1)
Transcription factors [BR:sce03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, not assigned
    YDR451C (YHP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:complement(1361120..1362181)
Genome map
AA seq 353 aa AA seqDB search
MESRNTVLPSLPNIITGTSNSPFQLHTLPNTNFPSDDQGDIRLPPLAASAHIVRPVVNIY
KSPCDEERPKRKSPQAVDFLSQRVTTSMTPLSKPKKLSSHSPFTPTVRVCSKEQPPQSMH
SYKKVNILTPLSAAKAVLTPTTRKEKKRSFAFITHSQETFPKKEPKIDNARLARRKRRRT
SSYELGILQTAFDECPTPNKAKRIELSEQCNMSEKSVQIWFQNKRQAAKKHKNSGNTSHC
KVHSNDSMSMISYSDAALEITSTPTSTKEAITAELLKTSPANTSSIFEDHHITPCKPGGQ
LKFHRKSVLVKRTLSNTGHSEIIKSPKGKENRLKFNAYERKPLGEVDLNSFKN
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcagaaataccgtgcttccttctttaccaaacattattacaggtacttctaat
tcgcctttccaactgcatactttgccaaatacaaacttccctagtgatgaccaaggtgac
atcaggttgccaccattagctgcatctgcgcacattgtgagaccagtggtaaatatttat
aaaagtccttgcgatgaggaaaggccaaaaaggaaaagtccacaggctgtggatttctta
tcacaacgtgtaaccacttccatgacgcctttatccaagcccaagaagctgagctctcat
tcaccattcacgccaacggtcagagtctgttctaaagagcagccacctcagagtatgcac
tcttataaaaaagttaatattcttactcctctatctgctgcaaaggctgttctcacacca
accacaagaaaagaaaagaaaaggtcatttgcctttattacacactcacaggaaactttt
ccaaagaaggagcctaagatagacaatgctcggttagctcgtcggaaaagaagaagaact
tcatcatatgagcttgggatattgcaaacagcatttgacgaatgtcccacgcccaataag
gctaaaaggatagagttatccgagcaatgtaatatgtccgaaaaatcggttcaaatatgg
tttcagaacaaaaggcaggctgctaaaaagcacaagaacagtggcaacaccagccattgc
aaagttcactctaatgattcgatgtctatgatatcttactcagacgctgcgttggaaatt
acctctacgccaacgagtacgaaggaggctattactgcagagttgctgaaaacttcacct
gccaatacgtcctcgatcttcgaagaccaccacataacgccttgcaagcccggcggacag
ctcaagttccacaggaaatctgtgcttgttaagagaacattatcaaataccggtcatagc
gagattatcaaaagtcctaaaggcaaggaaaaccgcctaaagttcaatgcatacgaaaga
aaaccccttggggaggtcgatctcaattctttcaaaaactaa

DBGET integrated database retrieval system