KEGG   Saccharomyces cerevisiae (budding yeast): YDR454CHelp
Entry
YDR454C           CDS       T00005                                 

Gene name
GUK1, PUR5
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sce00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
IV:complement(1366264..1366827)
Genome map
AA seq 187 aa AA seqDB search
MSRPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDYNFVSVDEFK
SMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKAIPELNARFLF
IAPPSVEDLKKRLEGRGTETEESINKRLSAAQAELAYAETGAHDKVIVNDDLDKAYKELK
DFIFAEK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtcctatcgtaatttctggcccaagtggtacaggtaaatctacactgttgaag
aaattgttcgctgaatacccagattctttcgggtttagtgtttcatccactactagaacc
ccaagagctggcgaagtaaacggtaaggactataactttgtctccgtagatgaattcaaa
tctatgattaagaacaatgaattcattgaatgggcgcaattctccggtaactactatggt
agtactgtcgcttccgtcaaacaagtcagtaaatctggtaagacttgtattttagatatt
gatatgcagggtgtcaaatctgtcaaggctatcccagagttaaatgccaggtttttgttt
attgctccaccatcggtcgaggatttgaaaaaaagattagaaggtagaggtacggagacc
gaagaatccatcaacaagaggttaagcgccgctcaagctgaattggcatatgctgagaca
ggtgcccatgacaaagttattgtcaatgatgatttggacaaggcctacaaggaattgaag
gattttatctttgcagaaaaatga

DBGET integrated database retrieval system