KEGG   Saccharomyces cerevisiae (budding yeast): YDR477WHelp
Entry
YDR477W           CDS       T00005                                 

Gene name
SNF1, CAT1, CCR1, GLC2, HAF3, PAS14
Definition
Snf1p (EC:2.7.11.1)
Orthology
K12761  
carbon catabolite-derepressing protein kinase [EC:2.7.11.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    YDR477W (SNF1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     YDR477W (SNF1)
Protein kinases [BR:sce01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   YDR477W (SNF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Structure
PDB: 

Jmol
Position
IV:1412373..1414274
Genome map
AA seq 633 aa AA seqDB search
MSSNNNTNTAPANANSSHHHHHHHHHHHHHGHGGSNSTLNNPKSSLADGAHIGNYQIVKT
LGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYD
VIKSKDEIIMVIEYAGNELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKP
ENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGV
ILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEI
MQDDWFKVDLPEYLLPPDLKPHPEEENENNDSKKDGSSPDNDEIDDNLVNILSSTMGYEK
DEIYESLESSEDTPAFNEIRDAYMLIKENKSLIKDMKANKSVSDELDTFLSQSPPTFQQQ
SKSHQKSQVDHETAKQHARRMASAITQQRTYHQSPFMDQYKEEDSTVSILPTSLPQIHRA
NMLAQGSPAASKISPLVTKKSKTRWHFGIRSRSYPLDVMGEIYIALKNLGAEWAKPSEED
LWTIKLRWKYDIGNKTNTNEKIPDLMKMVIQLFQIETNNYLVDFKFDGWESSYGDDTTVS
NISEDEMSTFSAYPFLHLTTKLIMELAVNSQSN
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtaacaacaacacaaacacagcacctgccaatgcaaattctagccaccaccac
caccatcaccaccatcaccaccaccatcacggtcatggcggaagcaactcgacgctaaac
aatcccaagtcgtccttagcggatggtgcacatatcgggaactaccaaatcgtcaaaacg
ctgggagaggggtcctttggtaaagttaaattggcatatcataccactacgggccaaaaa
gttgctctaaaaatcattaataagaaggttttggcaaagagtgatatgcagggcagaatt
gaaagagaaatatcttatctgagactcttaagacacccccacatcatcaaactgtatgat
gttatcaaatccaaagatgaaatcattatggttatagagtacgccgggaacgaattgttt
gactatattgttcagagagacaaaatgagcgagcaagaggcaagaagatttttccagcag
atcatcagtgccgtcgagtactgccataggcacaaaattgtccatagagatctgaagcct
gaaaacttactactagatgagcatctgaatgtaaagattgccgattttggtttgtcaaac
atcatgactgatggtaatttcttaaagacttcttgtggttctcccaattatgcggctcct
gaagttatcagcggtaagctgtacgcaggcccagaagtggacgtgtggtcatgtggggtt
atcctttatgttatgctttgtcgtcgtctaccgtttgacgatgaaagcatcccagtgctt
ttcaagaatatcagcaacggtgtttacaccttgcctaaatttttatctcctggagctgct
gggctaatcaaaagaatgttaatcgttaatccattgaacagaataagcattcatgaaatt
atgcaagacgattggttcaaagttgacctgccagaatatctacttccaccagatttgaaa
ccacacccagaagaagagaatgaaaataatgactcaaaaaaggatggcagcagcccagat
aacgatgaaattgatgacaaccttgtcaatattttatcatcgaccatgggttacgaaaaa
gacgagatttatgagtccttagaatcatcagaagacactcctgcattcaacgaaattagg
gacgcgtacatgttgattaaggagaataaatctttgatcaaggatatgaaggcaaacaaa
agcgtcagtgatgaactggatacctttctgtcccagtcacctccaacttttcaacaacaa
agcaaatcccatcaaaagagtcaagtagatcatgaaactgccaagcaacacgcaagaagg
atggcaagtgctatcactcaacaaaggacatatcaccaatcacccttcatggatcagtat
aaagaagaagactctacagtttccattttgcctacatctttacctcagatccacagagct
aatatgttagcacaaggttcgccagctgcctctaaaatatctcctcttgtaacgaaaaaa
tctaaaacgagatggcattttggtatacgatctcgctcatatccattagacgttatgggt
gaaatttatattgccttgaagaatttgggtgccgaatgggccaagccatctgaagaggat
ttatggactatcaaattaaggtggaaatatgatattggaaacaagacaaacactaatgaa
aaaatacctgatttaatgaaaatggtaattcaattatttcaaattgaaaccaataattat
ttggtggatttcaaatttgacggctgggaaagtagttatggagatgatactactgtttct
aatatttctgaagatgaaatgagtactttttcagcctacccatttttacatttaacaaca
aaactaattatggaattagccgttaacagtcaaagcaattga

DBGET integrated database retrieval system