KEGG   Saccharomyces cerevisiae (budding yeast): YDR481CHelp
Entry
YDR481C           CDS       T00005                                 

Gene name
PHO8
Definition
Pho8p (EC:3.1.7.6 3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sce00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:complement(1418550..1420250)
Genome map
AA seq 566 aa AA seqDB search
MMTHTLPSEQTRLVPGSDSSSRPKKRRISKRSKIIVSTVVCIGLLLVLVQLAFPSSFALR
SASHKKKNVIFFVTDGMGPASLSMARSFNQHVNDLPIDDILTLDEHFIGSSRTRSSDSLV
TDSAAGATAFACALKSYNGAIGVDPHHRPCGTVLEAAKLAGYLTGLVVTTRITDATPASF
SSHVDYRWQEDLIATHQLGEYPLGRVVDLLMGGGRSHFYPQGEKASPYGHHGARKDGRDL
IDEAQSNGWQYVGDRKNFDSLLKSHGENVTLPFLGLFADNDIPFEIDRDEKEYPSLKEQV
KVALGALEKASNEDKDSNGFFLMVEGSRIDHAGHQNDPASQVREVLAFDEAFQYVLEFAE
NSDTETVLVSTSDHETGGLVTSRQVTASYPQYVWYPQVLANATHSGEFLKRKLVDFVHEH
KGASSKIENFIKHEILEKDLGIYDYTDSDLETLIHLDDNANAIQDKLNDMVSFRAQIGWT
THGHSAVDVNIYAYANKKATWSYVLNNLQGNHENTEVGQFLENFLELNLNEVTDLIRDTK
HTSDFDATEIASEVQHYDEYYHELTN
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgatgactcacacattaccaagcgaacagacacgtcttgttcctggatctgactcgagc
tctcgtcctaaaaagagacggatctcgaagagatcaaagataatagtatccactgtggtc
tgtattggtttgttgctggttttagtgcaactggcatttccaagcagttttgcattacgt
tctgcatcacacaagaagaagaatgtcatattcttcgtgacggatgggatgggacctgcg
tctttgtccatggcaagatcattcaaccagcatgttaatgatttacctatagacgacatc
ctgacacttgacgagcattttatcgggtcttcgagaacaaggtcctcggactcactagtc
actgactcagctgcgggcgccaccgcatttgcatgtgcattaaagagctataatggggcc
atcggtgttgatccgcatcacagaccttgtggtacagtgctcgaggcggctaagttagca
ggttatctcactgggcttgttgttacgacaagaatcacagatgccactccggcttcattc
agttcacatgttgattacagatggcaggaagatcttatcgctacgcaccagttaggcgaa
tatcctctggggagagtagtagacttactcatgggtggcggcaggagccatttctaccct
caaggcgaaaaggcttctccatatggtcaccacggtgctagaaaagatggaagagattta
atcgatgaggctcaatctaatggctggcagtacgtgggtgaccgtaaaaattttgattct
ttgttgaaaagccacggtgaaaacgttactttacctttcttgggtctctttgcagataac
gacattccttttgaaattgacagagatgaaaaggagtatccttcccttaaggaacaagtc
aaggtggctttgggtgccttggaaaaagcttccaatgaggacaaagattctaatgggttt
ttcttaatggtggaaggctccagaattgatcatgctggtcaccaaaacgatccagcttcg
caggtaagggaggtgttggctttcgatgaagcattccaatacgttttggagtttgctgaa
aattccgatacggagactgttttggtctctacgtcggatcatgaaacgggtggtttagtc
acttcaagacaagtcactgctagctatcctcagtatgtctggtatccacaggtgctcgcc
aacgccacccattcaggtgagtttttgaaaagaaaactagtagattttgttcatgagcat
aagggcgcaagcagcaaaatagaaaatttcatcaaacatgagatcctggaaaaagatttg
ggtatttacgattacacggatagcgatttagaaacattaattcatttggatgacaacgca
aatgctatccaagacaaactgaatgacatggtatcatttagggcccaaattggctggacc
acgcatggtcacagcgcagtcgacgtcaacatatatgcatacgccaataagaaagctaca
tggtcatatgtcttgaacaatttacaaggcaatcacgaaaatacggaagttggccagttc
ttagaaaactttttagaattgaacctgaacgaagtcactgatttgattagggacaccaaa
cacacatcagattttgatgctacagaaatagctagtgaagtacaacattatgacgaatac
taccatgagttgaccaactga

DBGET integrated database retrieval system