KEGG   Saccharomyces cerevisiae (budding yeast): YDR499WHelp
Entry
YDR499W           CDS       T00005                                 

Gene name
LCD1, DDC2, PIE1
Definition
Lcd1p
Orthology
K12578  
DNA damage checkpoint protein LCD1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YDR499W (LCD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:1447830..1450073
Genome map
AA seq 747 aa AA seqDB search
MRRETVGEFSSDDDDDILLELGTRPPRFTQIPPSSAALQTQIPTTLEVTTTTLNNKQSKN
DNQLVNQLNKAQGEASMLRDKINFLNIEREKEKNIQAVKVNELQVKHLQELAKLKQELQK
LEDEKKFLQMEARGKSKREVITNVKPPSTTLSTNTNTITPDSSSVAIEAKPQSPQSKKRK
ISDNLLKKNMVPLNPNRIIPDETSLFLESILLHQIIGADLSTIEILNRLKLDYITEFKFK
NFVIAKGAPIGKSIVSLLLRCKKTLTLDRFIDTLLEDIAVLIKEISVHPNESKLAVPFLV
ALMYQIVQFRPSATHNLALKDCFLFICDLIRIYHHVLKVPIHESNMNLHVEPQIFQYELI
DYLIISYSFDLLEGILRVLQSHPKQTYMEFFDENILKSFEFVYKLALTISYKPMVNVIFS
AVEVVNIITSIILNMDNSSDLKSLISGSWWRDCITRLYALLEKEIKSGDVYNENVDTTTL
HMSKYHDFFGLIRNIGDNELGGLISKLIYTDRLQSVPRVISKEDIGMDSDKFTAPIIGYK
MEKWLLKLKDEVLNIFENLLMIYGDDATIVNGEMLIHSSKFLSREQALMIERYVGQDSPN
LDLRCHLIEHTLTIIYRLWKDHFKQLREEQIKQVESQLIMSLWRFLVCQTETVTANEREM
RDHRHLVDSLHDLTIKDQASYYEDAFEDLPEYIEEELKMQLNKRTGRIMQVKYDEKFQEM
ARTILESKSFDLTTLEEADSLYISMGL
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgagacgagaaacggtgggtgaattttcttcagatgacgatgatgatattcttttggaa
ttaggcaccaggcctccaaggtttactcaaataccgccatcatcagcagcattacaaaca
caaattcccactactttggaggttacaacgaccacattaaacaataaacagagtaaaaat
gataaccaactggttaaccaactgaataaagctcaaggtgaagcaagcatgcttcgtgat
aaaataaactttttgaacattgaaagggaaaaggaaaagaatattcaagccgtcaaagtt
aatgaattgcaagtcaagcatcttcaagagttggctaaattaaaacaagaattacagaaa
ctggaagatgagaagaagttcttacagatggaagcgagaggaaaatcgaaaagggaagtt
attacgaatgtaaaaccaccgtcaacaacattatcaacaaacacaaacactataacgcca
gattcgtcctcagttgcaatcgaagcaaaacctcaatcaccacaatcaaaaaaacgtaag
ataagtgataatttactgaaaaaaaatatggttcccctaaacccaaataggattattccc
gatgaaacgagtttatttctagagtcaatattacttcatcaaataataggcgctgacctg
agcacaatagaaatattaaatagattgaagcttgactacatcacagagtttaaatttaag
aatttcgtcattgctaaaggagcccccatagggaagtccatagtttctctacttttgcga
tgtaaaaagacgttgaccctcgacaggttcatagatactttgctagaggatatagctgtt
ttgatcaaggaaatatcagttcatccaaatgaatcgaaattagctgtcccatttctcgtt
gcattgatgtatcagattgtacaatttcgtcctagtgccactcataatttagcactgaag
gattgttttctttttatttgcgatttaataagaatctatcatcatgtattgaaagtaccg
atacatgaatcaaatatgaatttgcatgtagaacctcagattttccaatatgaactgata
gactatttgataatttcgtattcctttgatctcctagaaggtatattaagggtactgcag
tcgcatcctaagcaaacttatatggaattttttgatgaaaatattctaaaatcatttgaa
tttgtctacaaactagcactaaccatttcatacaagccaatggtaaatgtaatatttagt
gcagtcgaggtcgttaatattatcactagtataatattaaatatggacaattcctcagat
ctgaaatccttgataagcggtagttggtggagagattgtattacaagattatacgctctt
ttggaaaaggaaattaagagtggcgacgtatataatgaaaatgtggatactacaactctt
catatgtcgaagtaccatgacttttttgggttaatccgaaatataggtgataatgaattg
ggaggattgatatcaaagctgatttatactgaccgattgcaaagtgtcccaagggtaatt
tctaaagaggatattgggatggatagcgacaaattcactgcccctataataggttacaag
atggaaaaatggcttttgaagttaaaagatgaagttttaaatatttttgaaaatttatta
atgatctatggagacgatgcgaccatagtaaatggagaaatgctcatccactcctctaaa
ttcttatccagggagcaagcgttaatgatagaaaggtacgtgggacaagactccccgaac
ttggacctcagatgccatcttattgaacatactttaaccataatatataggctatggaaa
gaccatttcaaacaattgcgtgaagaacaaatcaagcaggtagaaagccaattgattatg
tcactatggaggtttctcgtatgccaaaccgaaactgtgacagcaaacgaaagagaaatg
agagatcatcgacaccttgtagatagtttgcatgatctgacgataaaggatcaagcctct
tattacgaagatgcctttgaggatttaccagaatatatcgaagaagaattgaagatgcaa
ttgaataaaagaacggggagaataatgcaagtaaagtacgatgagaaatttcaagaaatg
gcaagaactattcttgagtcaaaatcattcgatctaaccacactagaggaggccgattca
ttatatatctcaatgggactgtaa

DBGET integrated database retrieval system