KEGG   Saccharomyces cerevisiae (budding yeast): YDR507CHelp
Entry
YDR507C           CDS       T00005                                 

Gene name
GIN4, ERC47
Definition
Gin4p (EC:2.7.11.1)
Orthology
K06668  
serine/threonine-protein kinase GIN4 [EC:2.7.11.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YDR507C (GIN4)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.-  
     YDR507C (GIN4)
Protein kinases [BR:sce01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   YDR507C (GIN4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
SGD: 
MIPS: 
UniProt: 
Position
IV:complement(1462358..1465786)
Genome map
AA seq 1142 aa AA seqDB search
MAINGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNV
SGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN
LLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL
ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT
LLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKS
IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALL
YRFKCDTQKELIKQQQVKKRQSISSVSVSPSKKVSTTPQRRRNRESLISVTSSRKKPISF
NKFTASSASSSNLTTPGSSKRLSKNFSSKKKLSTIVNQSSPTPASRNKRASVINVEKNQK
RASIFSTTKKNKRSSRSIKRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTS
SNFATLIDEIFEYEKYEQIRKEKEELERKVREAKAREELERRRRKQEEKERARKLLEKED
LKRKQEELKKQIEIDISDLEQELSKHKEEKLDGNIRSISAPMENEEKNINHLEVDIDNIL
RRRNFSLQTRPVSRLDPGIMFSSPTEEVSPVEPKRTENERLTTEKKILETIRRSKFLGSS
FNIDKELKLSKMEYPSIIAPQRLSEERVVSDSNDGYESLILPKDGNGVSQLKDSTATTAP
VSDGRLRKISEIRVPQFTRKSRHFSESNKRLSVLSMYSTKESFTNLVDILKNGNLDVNNQ
QSQRIPTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKDKSALKLNFADRFN
GSNEAKQTDNLHLPILPPLNGDNELRKQNSQEGDQAHPKIKSMIPESGSSSHTEKEEENE
EKEEKKPEQHKQEEDQEKREKVVDDMEPPLNKSVQKIREKNAGSQAKDHSKDHLKEHKQD
KNTAIGNGSFFRKFSKSSDKTMELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLT
LTGKLSSDNIFSLRSTLFEVNIYPRGKMSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVL
QK
NT seq 3429 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcaatggtaacagtattcctgccataaaggataataccatcggtccatggaaa
ctaggtgaaactctcggtctagggagcactggtaaagtccagcttgctcgtaatggatcc
acaggacaagaggcggcagttaaggtaatatcaaaagcagtattcaataccggtaatgtc
agcggtacttcgattgttggctccaccaccccagatgctctaccatatggtatagaacgc
gaaataatcattatgaagttgttaaaccacccaaatgtgttacgtttatatgatgtctgg
gaaacaaatacagatttataccttgttttagaatacgcggagaaaggtgagttgttcaac
ttattggttgagagaggtcctctgccagagcatgaagctatcaggttttttagacaaatt
attattggtgtgtcgtactgtcatgcgttgggtattgtccatcgtgatctaaaaccggaa
aatctattattagatcataaatataacatcaagattgcagattttggtatggctgctttg
gaaactgaaggaaagctactggagacgtcgtgcggatcaccacattatgctgcaccagaa
attgtatctggtataccgtatcaaggtttcgcaagtgatgtgtggtcatgcggtgtgatc
ctattcgcccttcttactggtcggttaccctttgacgaggaagatggaaatataagaaca
ctattacttaaagttcaaaaaggtgagttcgaaatgccttctgatgatgaaatttcgcgt
gaagctcaggatttgattagaaaaatcttaaccgttgatcctgaaagaagaatcaagacc
agagatatactcaaacatccgctattacaaaaatatccaagtataagagattctaaaagt
attagaggcttaccaagagaagacacatatctcacgccattatcagaaagtaattcttct
attgacgctacgattttgcaaaatttagtaatattatggcatggaagagatcctgaagga
attaaggaaaaactaagagaacctggcgctaatgcagaaaagacattatatgcactactg
tatagatttaagtgtgacactcaaaaagagcttattaagcaacagcaagttaagaagagg
cagtcaattagtagcgtttctgtttccccatctaaaaaagtatcgacaactccacaacgc
agaagaaatagagaatctttaattagtgtaacatcttctcgtaaaaagccaatatccttc
aacaaattcactgcctccagtgcctcctccagcaatctaactacacccggttcttcaaaa
cgcctttcaaaaaacttctcttcaaagaagaaattatctacaatcgttaaccaatcttct
ccaacaccagcatcacgtaataaaagagcttcggttataaatgtggaaaagaatcaaaaa
agagcctctatcttttctactaccaagaagaacaaaagatcttctagatctatcaagaga
atgtcattgataccaagcatgaaacgtgaatcggtgacaacaaaattaatgtcaacatat
gcgaaattggcagaggatgacgattgggaatacattgagaaggaaacaaagagaacgagc
tcaaattttgcaactttgatagatgaaatttttgagtacgaaaagtacgaacaaataagg
aaagagaaggaagagctagaacgtaaagtgagagaagcaaaagcacgtgaagagctggaa
cgtagaagacgtaaacaagaagaaaaagaacgtgcaagaaaattactagaaaaggaagat
ctgaaaagaaaacaggaggaactcaagaagcaaattgaaattgatataagtgatctagag
caagagctgtccaaacacaaagaggaaaaactggatggtaatattagatctatctctgct
cctatggaaaatgaagagaaaaatatcaatcatttggaggttgatattgacaatattctc
cgtcgccgcaacttttctttacaaactagacctgtgtcaaggcttgatccgggtataatg
ttctccagtccaactgaggaagtaagtccagtggaaccaaagagaacagaaaatgaaaga
cttacaacagaaaagaaaattttagaaactatcagaagatcaaaattcttgggttcatca
tttaatatcgataaagagttgaaattgtctaaaatggaatatccaagtataattgcacca
caaagattgtcagaggagcgagtggtgtcagattctaatgatggatatgaatctttgatc
ctcccgaaggatgggaatggcgtatctcaattaaaggatagtaccgcaacaactgctccc
gtctctgatggtaggttgaggaagatctctgaaattagagtaccacaatttactagaaaa
tcaaggcattttagtgagtccaataaaaggctatctgtcctgtcgatgtactctaccaag
gagtcgtttaccaacttggttgatattttgaaaaacggtaaccttgatgtcaataaccaa
caaagccaaagaattccaacaccaagaagtgcggatgattcagaatttctttttgaaact
gtcaacgaagaagctgaatatacaggaaatagttcgaacgatgagagattgtacgatgtc
ggtgattccactatcaaagacaaatccgcgttaaagctgaactttgcagatcgttttaat
ggatcgaacgaagcgaaacaaactgataacttacatcttccgatccttcctccgcttaat
ggtgacaatgaattgcgtaaacagaatagccaagagggtgaccaggcacatccaaagatt
aaatcgatgataccagaatcaggctcttcttcacatactgaaaaggaagaagaaaatgag
gaaaaggaagagaaaaagccagaacaacacaaacaagaagaggatcaagaaaaaagagag
aaagtagtagatgatatggagccaccattgaacaaatctgtgcaaaaaattagggaaaaa
aatgctggctcgcaggcaaaggatcattcaaaagatcacttaaaagagcataagcaggat
aaaaatacagcaattggaaatggttccttctttagaaaattctcaaaatcttcggacaaa
acaatggaattgtatgccaagatttctgcaaaacaattgtttaatggtttagagaagctg
ttgcgtggttggactcagtatggtttaaaaaatataaaatcgcaccccaacaatctgacc
ttaacgggtaaactatcgagtgataatatattctcactacgttcaacactctttgaggtt
aatatttatccgagaggtaagatgagcgttgtgcagttcaagaaagtttctggttcattc
aaagctgtcaaaaagttggtcaatgaagttgagaacgtcctgaataaggaaggcgttcta
caaaaatag

DBGET integrated database retrieval system